(data stored in SCRATCH zone)

EMBL: CP000272.PE16

CP000272.PE16        Location/Qualifiers
FT   CDS_pept        complement(21847..22848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0017"
FT                   /product="Response regulator receiver domain protein(CheY)"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0017"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35944"
FT                   /db_xref="GOA:Q13IZ5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ5"
FT                   /protein_id="ABE35944.1"
FT                   /translation="MHTIKPFYFPTTVTFVDDSAAFLSNLCLQLDPQLAFRLFSSPGEA
FT                   LEFVNSRPRPGPSDEPLFAPFRDRTDEDLAHQVIALSVNTVRKQVHNAQRFLATSVVVV
FT                   DYDMPGMNGLEFCRRMTDPAVRKIMLTGKADEHIAVQSFNEGIIHRFIRKQDASAVPAL
FT                   NRAVRDLQNAYFDDVCQSILDTLAVSEYAFLRDEALAARVAELAASLGIVEHYLSYCPG
FT                   GLLMLDSAGKSYLLIVHTDETLRGLREIAVEQEAPAEFLAALDSRRSLPYFWQTEGHYP
FT                   ADCTAWENYMHPATQFSGRQNYVYAVIPNPPGLDLSQVLSYDRYLERLDRDL"
     atgcacacga tcaaaccatt ctattttccg accaccgtca cgttcgtcga cgacagcgcg        60
     gccttcctgt cgaatctgtg ccttcagctt gacccgcagc ttgccttccg cctcttcagc       120
     tcgccgggcg aggcgctcga attcgtgaac agccgtcccc ggccggggcc gtcggacgaa       180
     ccgctgttcg cgccgtttcg cgaccgcacc gacgaggatc tcgctcacca ggtcatcgcg       240
     ctgagtgtca acacggtccg caaacaggtt cacaacgcgc agcgttttct ggcgacgtcg       300
     gtcgtggtcg tcgattacga catgcccggc atgaacggtc tcgagttctg ccgccgcatg       360
     accgaccctg ccgtgcgcaa gatcatgctg accggcaagg cggacgaaca catcgcggtg       420
     cagagcttca acgaaggcat cattcatcgc ttcatccgca agcaggacgc gtcggcggtg       480
     ccggcactga atcgcgcggt gcgcgacctg cagaacgcct atttcgacga cgtgtgccag       540
     tcgatactcg ataccctcgc ggtctcggag tacgcgtttc tgcgcgacga ggcgctcgct       600
     gcgcgggtgg ccgaacttgc ggcctcgctg ggtattgtcg agcactatct gtcgtactgc       660
     ccgggcgggc tgctcatgct cgacagcgcg ggcaaatcct atctgctgat cgtccacacc       720
     gacgaaacct tgcgcggcct gcgtgaaata gccgtcgaac aggaagcgcc ggcagagttt       780
     ctggcggcgc tggatagtcg gcggagcttg ccgtacttct ggcaaaccga aggacattac       840
     cccgccgatt gcacggcatg ggaaaactac atgcacccgg caacgcaatt cagcggccgg       900
     cagaattacg tctacgcggt cattcccaac ccgccggggc tggatctgag ccaggtgctc       960
     agctatgacc gctaccttga acggctcgac cgcgacctgt aa                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page