(data stored in ACNUC7421 zone)

EMBL: CP000272.PE161

CP000272.PE161       Location/Qualifiers
FT   CDS_pept        complement(178913..179434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0164"
FT                   /product="Competence/damage-inducible protein CinA"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0164"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36089"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IK0"
FT                   /protein_id="ABE36089.1"
FT                   /translation="MNIPMQAVSFLSSRGLKLATAESCTAGQIASYLASVPGSGSCLDV
FT                   GFVSYSPSGKAGFLGVKESTMKQFGLTSEEVAREMAEGALRQEGCCADVVVSNTGLADP
FT                   AAAGSPPAGTQCFAWSFRMREANIVTFSETRRFSGGRNDVRSAAALYALSRIEHYFNQL
FT                   PSARRERHTR"
     atgaacattc ccatgcaggc cgtgtctttc ctgtcgtcgc gcggtctcaa gctggctacc        60
     gccgagtcat gcaccgctgg tcagatcgcg tcttacctcg cgagcgtgcc cggcagcggg       120
     tcatgcctcg atgtcggttt tgtcagctat tccccttcgg gaaaggcagg ctttctcggc       180
     gtgaaggaat cgacaatgaa gcagttcggc ctgaccagcg aggaagtcgc ccgcgaaatg       240
     gcggaaggcg cccttcgtca ggaaggctgc tgtgccgacg tggtggtgtc caacacaggg       300
     cttgccgatc cagcggccgc cggcagtccg cccgcaggca cccagtgttt cgcgtggtct       360
     tttcgcatgc gcgaggcgaa tatcgtcacg ttttccgaaa cgcggcgctt ttccggcggc       420
     aggaacgatg tccgctccgc tgcggcgctg tacgcgctct cgcgcatcga gcactacttc       480
     aatcaactcc cgtcagcgag gcgggaacga cacacgaggt ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page