(data stored in ACNUC7421 zone)

EMBL: CP000272.PE162

CP000272.PE162       Location/Qualifiers
FT   CDS_pept        179675..179878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0165"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36090"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ9"
FT                   /protein_id="ABE36090.1"
FT                   /translation="MNKDQREGLKEELKGYVNKGIGSITGNEDRKVKGEVQITNGDNRK
FT                   DLGDQEDSIDRNAIDPGNPSNL"
     atgaacaagg accagcgtga aggcctcaag gaggagctca aaggttacgt caacaagggc        60
     atcggctcga tcaccggaaa cgaagaccgg aaggtcaaag gcgaagtgca gatcaccaac       120
     ggcgacaacc gcaaggatct gggcgatcag gaagacagta tcgacaggaa cgcgatagat       180
     ccgggaaatc catcaaacct ctag                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page