(data stored in ACNUC7421 zone)

EMBL: CP000272.PE164

CP000272.PE164       Location/Qualifiers
FT   CDS_pept        181592..182707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0167"
FT                   /product="Putative cytochrome c oxidase subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0167"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36092"
FT                   /db_xref="GOA:Q13IJ7"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034236"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ7"
FT                   /protein_id="ABE36092.1"
FT                   /translation="MIPGVGFDMCAAAPQCSMGAWPRRRRLGPLAAVSLCPMSYVAKVG
FT                   AQPQQSALQPAGVQAAHIAKLWNLSLIVCGIVFALVLLATLVALIRNGRHAATPAQTTQ
FT                   PPDLSSLTRPEHRTRRIVIGVSVMSVIVLVGLIVADVLTDRALSKLPVDDPLRIDMVGA
FT                   QWWWQASYRPEGGRPGFVTANELHVPVGRPIVVSLQAADVIHSFWVPNLHGKKDLLPGI
FT                   DTTIEFRADQPGVYRGQCAEYCGAEHALMAMLVVAEPRERYAAWVARQARPAAQSADAV
FT                   ALQGRAVFERASCAHCHTVRGSSAQGTPGPDLTHLMSRETIAAGVLANTPQNLAAWIRD
FT                   PDALKPGTTMPAVPLSDTDRVAVVRWLRTLQ"
     atgatccccg gcgttggatt cgacatgtgc gcggccgcgc cgcaatgcag catgggcgcg        60
     tggcccaggc ggagacggct ggggcctctc gcggccgtct cgctatgccc catgtcgtac       120
     gtcgcgaagg tgggggcgca gccgcagcaa agcgcattgc agccagcagg cgtacaggca       180
     gcacacatcg cgaagctgtg gaatctgtca ctgatcgtct gcgggatcgt cttcgcgctc       240
     gtgctgctcg ccacgctcgt cgcgctgatc cgcaacggac gacatgccgc cacgccggcg       300
     cagacgaccc agccgcccga tctgagttcg ctcacgcggc cggagcatcg cacgcggcgt       360
     atcgtcatcg gcgtgagcgt gatgtccgtc atcgttctcg tcggactgat cgtcgcggac       420
     gtgctcacgg accgcgcact gtcgaagctg ccggtcgacg acccattgcg tatcgatatg       480
     gtcggcgcgc aatggtggtg gcaggcgtca tatcgccctg aaggcggacg gccgggcttc       540
     gtcaccgcga acgaattgca tgtgccggtc ggccgtccga tcgtcgtatc gttgcaggcg       600
     gccgacgtga tccatagttt ctgggtgccg aacctgcacg gcaagaagga cctgttgccc       660
     ggcatcgata cgacgatcga gtttcgcgcc gaccagccgg gcgtctatcg cgggcaatgc       720
     gctgaatatt gcggcgccga acatgcgttg atggcgatgc tcgtcgtcgc cgagccgcgc       780
     gagcgttacg cggcgtgggt cgcacgccag gcgcggcccg ccgcgcagag cgccgacgcc       840
     gtcgcgctgc agggccgcgc ggtgttcgag cgcgcgagtt gcgcgcattg ccatacggta       900
     cgcggcagtt ccgcgcaggg cacgcccggc cccgacctca cgcatctgat gagccgtgag       960
     acgatcgccg ccggtgtgct tgccaatacc ccgcagaacc tcgccgcgtg gatacgcgat      1020
     ccggacgcgc tgaagcccgg cacgacgatg ccggcggtgc cgctctcgga caccgatcgc      1080
     gtcgccgtcg tccgatggct taggacactg caatga                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page