(data stored in ACNUC7421 zone)

EMBL: CP000272.PE166

CP000272.PE166       Location/Qualifiers
FT   CDS_pept        185334..185678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0169"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36094"
FT                   /db_xref="GOA:Q13IJ5"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ5"
FT                   /protein_id="ABE36094.1"
FT                   /translation="MKRTGLSVWLGLLAAPAVVLGAQSLNYALVQLACATGRHTALDAV
FT                   SAVAFLFSMVAAWLAYRRWRGTATPFDASYVRRDARRPFLALMAMLVAALCAVIQLTMW
FT                   FPQWLLSPCR"
     atgaagcgca caggcctatc cgtgtggctc ggtctactcg cggcgcccgc agtcgtgctc        60
     ggcgcgcaga gcctcaacta cgcgctcgtg cagctcgcct gcgcgaccgg ccggcatacc       120
     gcgctcgacg cggtgagcgc ggtcgcgttc ctgttctcga tggtcgcggc gtggctcgcc       180
     taccggcgct ggcgcggcac ggccaccccg tttgacgcga gctacgtgcg gcgcgacgcg       240
     cgtcggccgt ttctcgcgct gatggcgatg ctcgtggccg cgttgtgcgc ggtgatccag       300
     ttgacgatgt ggtttccgca atggctgctt tcgccctgtc gatga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page