(data stored in SCRATCH zone)

EMBL: CP000272.PE171

CP000272.PE171       Location/Qualifiers
FT   CDS_pept        complement(192603..193130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0174"
FT                   /product="Putative hydrogenase/oxidoreductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0174"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36099"
FT                   /db_xref="GOA:Q13IJ0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IJ0"
FT                   /protein_id="ABE36099.1"
FT                   /translation="MWQLLKQIARTGTPDPRVPESDDAWRTESQQIQQDILDLLGRALC
FT                   IREIDAGSCNGCELEIHALNNPYYNLEGLGIRFVASPRHADMLLVTGPLTVNMTEAVRL
FT                   AYEATPDPKLVVATGECACTGGMFKESYAVCGPLAKLLPVDVTIPGCPPPPLDILRGIL
FT                   GALRVKRTTRAR"
     atgtggcaac ttctcaaaca gatcgcgaga accggcactc cggacccgcg cgtgccggaa        60
     agcgatgacg catggcgtac cgaaagccag cagatccagc aggacatact cgacctgcta       120
     ggccgggcgc tgtgcattcg cgagatcgac gcgggctcct gcaacggctg cgaactggaa       180
     atccacgcgc tcaacaatcc gtactacaac cttgaaggtc tgggtatcag gttcgtcgcg       240
     agtccccgcc atgccgacat gctactggtc accggcccgc tgaccgtgaa catgacggaa       300
     gcagtgcggc tggcatacga agcgacgcct gatccgaagc tggtggttgc caccggcgag       360
     tgcgcctgca ccggtggcat gttcaaggaa agctacgccg tatgtggacc gctcgcgaaa       420
     cttcttcctg tcgacgtcac gataccgggt tgtccgccgc cccccctcga tatcctgaga       480
     ggcattctcg gcgcgcttcg ggtgaaacgc acgacgcgcg cgcgatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page