(data stored in ACNUC7421 zone)

EMBL: CP000272.PE175

CP000272.PE175       Location/Qualifiers
FT   CDS_pept        complement(196815..197765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0178"
FT                   /product="Formate hydrogenlyase subunit 4"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0178"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36103"
FT                   /db_xref="GOA:Q13II6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II6"
FT                   /protein_id="ABE36103.1"
FT                   /translation="MITLSGLLSQGLEILLALAAAPLLTGWVNLCRARLQNRRAPSIWQ
FT                   PYRMLHKLFNKESVVADHASPLFRGAPYVVWACMTLACAIVPTLSTDLPLSPAADAIAL
FT                   VGLFALARVMISLAAMDIGTAFGTLGARREMLVGFLAEPALLMVLFSASLITQSTLLTR
FT                   IVSTLSHRELAIYPSLAFAGIAFAMVSLAENARLPVDNPTTHLELTMIHEALILEYSGR
FT                   HLALMEWATSLKLFAYSCIGLALFIPWGIAEAGSPAALLLAIPALFIKLLTGGAALAVV
FT                   ETSNAKMRLFRVPEFLATAFLLAVIGMLVHFLLGA"
     atgatcacgc tctccggatt gctctcccag gggctggaaa tcctgctcgc actggcggcg        60
     gctccgctgc tgacagggtg ggtcaacctg tgccgcgcgc gcttgcagaa ccgccgggcg       120
     ccgagcatct ggcagcccta ccggatgctg cacaagctgt tcaacaagga gtcggtcgtc       180
     gccgaccacg ccagcccgct attccgcggc gcgccctatg tcgtctgggc atgcatgacg       240
     ctcgcctgtg cgatcgtgcc cacgctgtcc accgatctgc cgctttcgcc ggccgcggac       300
     gcgatcgccc tggtcgggct tttcgcgctg gcccgcgtga tgatctcgct ggccgcgatg       360
     gacatcggca ccgccttcgg cacgctcggc gcgcgccgcg agatgctggt cggcttcctc       420
     gcggagccgg ccttgctgat ggtgctgttt tcggcgtcgc tgatcaccca gtccaccctg       480
     ctgacccgca tcgtctccac gctcagtcat cgcgagctgg cgatctatcc gagcctcgcg       540
     ttcgcgggaa tcgcgttcgc gatggtctcg ctcgccgaaa acgcgcgtct gccggtcgac       600
     aaccccacca cccatctcga actgacgatg atccacgagg cgctgatcct cgaatattcc       660
     ggccgccatc tcgcgctgat ggaatgggcc acgagcctca agctgttcgc gtactcctgc       720
     atcggcctcg cgttgttcat tccgtggggc atcgcggagg ccggcagtcc ggccgcgctg       780
     ctgctcgcga tacccgcgct gtttatcaag ctactgacag gtggcgcggc gctcgcggtc       840
     gtcgagacga gcaacgcgaa gatgcgcctt ttccgcgtgc cggagttcct cgcgacggcg       900
     ttcctgctgg ctgtcatcgg catgctcgtt cacttcctgc tgggggcgtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page