(data stored in ACNUC7421 zone)

EMBL: CP000272.PE179

CP000272.PE179       Location/Qualifiers
FT   CDS_pept        201962..202159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0182"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0182"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36107"
FT                   /db_xref="GOA:Q13II2"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II2"
FT                   /protein_id="ABE36107.1"
FT                   /translation="METKSARLTILIDPVKKEAFEKLCAAQDLTPSQVVRQLIRDYLDQ
FT                   HGVSYRTKSAIGARPRRKTA"
     atggaaacga aaagcgctcg actcacgatt ctgatcgatc ctgtgaagaa ggaagcgttc        60
     gaaaaactgt gcgcggcgca ggacctgacg ccctctcagg tggtgcggca actgatccgc       120
     gactatctcg atcagcatgg cgtcagctac cggaccaaaa gcgcaattgg cgcgcgtccg       180
     cgccgcaaaa ccgcctga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page