(data stored in SCRATCH zone)

EMBL: CP000272.PE181

CP000272.PE181       Location/Qualifiers
FT   CDS_pept        complement(204379..206271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0184"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0184"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36109"
FT                   /db_xref="GOA:Q13II0"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:Q13II0"
FT                   /protein_id="ABE36109.1"
FT                   /translation="MSTRDKEFPDLILHRGRFTTLDRNRPEATAVAIRQRVFTAVGSDA
FT                   EIVPLAGSATRVIDLLGLRVLPGLIDNHLHIIRGGLNFNMELRWDGVRSLATAMDMLRA
FT                   QVAITPPPQWVRVVGGFTEHQFDEKRLPTIDELNAVAPDTPVFILHLYDRAILNAAALR
FT                   VVGYTKDTAEPPGGEIVRDSAGNPVGLLLAKPNAGILYATLAKGPKLPPEYQVNSTRHF
FT                   MRELNRLGVTGAIDAGGGFQNYPEDYAVIQKLSDAGQLTIRLAYNLFTQKPKGEKEDFL
FT                   NWTKTSKYKQGTDYFRHNGAGEMLVFSAADFEDFRQPRPDMTPDMEGELEGVVRVLAEN
FT                   RWPWRMHATYDETISRALDVFEKVNRDIPLNGLNWFFDHAETISERSIDRIAALGGGIA
FT                   VQHRMAYQGEYFVERYGAQAAEATPPVARMLEKGVRTSAGTDATRVASYNPWVALAWLV
FT                   TGKTLSGLRIYPQRNCLDRETALRMWTENVTWFSNEEGRKGRIETGQFADLIVPDHDYM
FT                   SCPESDIAGTTSLLTVVGGKIVYGAGPFAKFDAPLPPAMPDWSPVRAYGGYAGWGAAQG
FT                   KEGTPLQRAAAQQCGCAHACGLHGHAHARAWTNNVPAADLKSFWGALGCACWAV"
     atgagcaccc gtgacaagga gttccccgat ctgatcctgc atcgcggccg cttcacgacg        60
     ctcgaccgca acaggccgga agccaccgct gtcgcgatcc ggcaacgcgt gttcaccgcc       120
     gtcggcagcg atgcggagat cgtgccgctc gccggtagcg ccacccgggt catcgacctg       180
     ctggggctac gcgtattgcc ggggctgatc gacaatcatc tgcacatcat ccgcggcggc       240
     ctgaatttca acatggaact gcgctgggac ggcgtgcgct cgcttgcgac cgcaatggac       300
     atgctgcgcg cgcaggtcgc catcacaccg ccgcctcaat gggtgcgcgt ggtcggggga       360
     tttaccgaac accagttcga cgaaaagcgg ctgcccacca tcgacgaact caatgccgtg       420
     gcgcccgata cgccggtgtt catcctgcat ctgtacgatc gcgcgattct caacgcagcc       480
     gcgctgcgcg tggtcggcta tacgaaggac accgccgaac cgcccggagg cgagatcgtg       540
     cgcgattcag ccggcaatcc ggtcgggctg ctgctcgcaa agccgaacgc cggcatcctg       600
     tacgcgacgc tggcgaaagg gccaaagctg ccgcccgaat accaggtcaa ttccacacgc       660
     catttcatgc gcgagttgaa ccggctcggt gtaaccggcg cgatcgacgc cggcggcggc       720
     ttccagaact atcctgaaga ctatgcggtg atccagaagc tttccgacgc agggcaactg       780
     acgatccgac tcgcctacaa cctgttcacg cagaaaccca agggcgagaa ggaagacttc       840
     cttaactgga ccaagacatc gaagtacaag cagggcaccg actacttccg tcacaacggc       900
     gcgggcgaga tgctggtgtt ttccgcagcg gacttcgagg actttcgcca gccgcgtccc       960
     gatatgacgc cggacatgga aggcgagctg gaaggagtcg tgcgtgtgct ggcggaaaat      1020
     cgctggccgt ggcggatgca cgcgacctat gacgagacga tcagtcgcgc gctcgatgtg      1080
     ttcgaaaagg tcaaccgtga tattccgctc aacggactga actggttctt cgatcatgcg      1140
     gaaacgatta gcgaacggtc gatcgatcgc attgccgcac ttggcggcgg catcgccgtg      1200
     cagcaccgga tggcctacca gggcgagtac ttcgtggagc gctacggcgc gcaggctgcg      1260
     gaggcgacgc caccggtcgc gcgcatgctc gaaaagggtg taaggacatc tgccgggact      1320
     gatgccacac gcgtcgcttc gtacaacccc tgggtcgcgc tcgcctggct cgtgaccggc      1380
     aagacactgt cgggactgcg gatctatcct caacgcaact gcctggatcg tgaaaccgcg      1440
     ctgagaatgt ggaccgagaa cgtcacatgg ttctcaaacg aggaaggcag gaagggccgc      1500
     atcgagacgg gccagttcgc cgacctgatc gtgccggatc acgactacat gagctgcccg      1560
     gagtccgaca tcgccggcac gacttcgcta ctgaccgtgg tcggcggcaa gatcgtgtat      1620
     ggcgcggggc cgttcgcgaa attcgatgcg ccgctgcctc cggcaatgcc cgactggtcg      1680
     ccagtgcgcg catacggcgg ctatgcggga tggggcgcgg cgcaaggcaa agaaggcacg      1740
     ccgctgcaac gggccgccgc gcaacaatgc ggatgcgcgc atgcctgcgg gttgcacggc      1800
     catgcgcacg cacgggcatg gacgaacaat gtgccggcag ccgacctgaa gagtttctgg      1860
     ggcgcattgg gatgcgcgtg ctgggccgtg tag                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page