(data stored in ACNUC7421 zone)

EMBL: CP000272.PE182

CP000272.PE182       Location/Qualifiers
FT   CDS_pept        complement(206268..206558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0185"
FT                   /product="Putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0185"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36110"
FT                   /db_xref="GOA:Q13IH9"
FT                   /db_xref="InterPro:IPR009872"
FT                   /db_xref="InterPro:IPR020017"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH9"
FT                   /protein_id="ABE36110.1"
FT                   /translation="MKLYIFSLLAGILVGVIYSLINVRSPAPPLVALVGLLGILAGEQL
FT                   IPVAKQMLSGSAFHTAWHESKCDQHMFGALPGRQTGDTSRTAAVNSPEKRS"
     atgaaactct atatcttctc cctgcttgcc ggcattctgg ttggtgtgat ctacagcctc        60
     atcaacgtgc gctcgccggc gccgccgctc gtcgcactag tcggtctgct cggcattctt       120
     gcgggcgaac agctcattcc ggtcgccaaa cagatgctgt cgggcagcgc cttccatacc       180
     gcgtggcacg agtcgaagtg cgatcagcat atgttcggcg cgctgcccgg acgccagacc       240
     ggcgacacgt cgcgcaccgc tgccgtcaat tcaccggaga aacgctcatg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page