(data stored in SCRATCH zone)

EMBL: CP000272.PE183

CP000272.PE183       Location/Qualifiers
FT   CDS_pept        207224..207931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0186"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0186"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36111"
FT                   /db_xref="GOA:Q13IH8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH8"
FT                   /protein_id="ABE36111.1"
FT                   /translation="MDHTMSNPKLEVLTPANSQIIFIDQQPQMAFGVQSIDRQVLKNNV
FT                   VGLARAASVFNIPTTITTVETESFSGYTYPELLDVFPGHPLLERTSMNSWDDQKVRDAL
FT                   AQNGRKKVVVSGLWTEVCNNTFALCAMDEGGYEIYMVADASGGTSKEAHDYAMQRMIQA
FT                   GVVPVTWQQVLLEWQRDWAHKDSYDAVMAIVREHSGAYGMGVDYAYTMVHKAAQRVRDK
FT                   HEVRAPVPAPISK"
     atggatcaca ccatgagcaa cccgaagctt gaagttctga ctcccgctaa cagccagatc        60
     attttcatcg accagcaacc ccaaatggcg tttggcgttc aatccattga ccgccaggta       120
     ttgaagaata atgttgtcgg cctcgccagg gcggccagcg tattcaatat tcccactacc       180
     atcacgacgg tcgaaaccga gagcttctct ggttatacct accccgaatt gctggacgtg       240
     ttccccgggc atccgctgct tgagcgcacg tcgatgaact catgggacga tcagaaggtg       300
     cgtgacgcgc tcgcgcagaa tggccgcaag aaagtggtgg tatcgggcct gtggaccgag       360
     gtatgcaaca acacctttgc gctatgtgcg atggatgagg gcggctatga aatctacatg       420
     gttgccgacg cgtccggcgg cacgtcgaaa gaggcgcacg actatgcgat gcagcgcatg       480
     atccaggcgg gcgtcgtgcc cgtgacgtgg cagcaggttc tgctggaatg gcaacgcgac       540
     tgggcgcaca aggactctta cgatgcggtg atggctatcg tcagggagca ttccggcgca       600
     tacggcatgg gcgtcgacta tgcgtacacg atggtccaca aggccgcgca gcgtgtgagg       660
     gacaagcacg aagtgcgcgc gccggtgccc gcgccgatat cgaagtag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page