(data stored in SCRATCH zone)

EMBL: CP000272.PE185

CP000272.PE185       Location/Qualifiers
FT   CDS_pept        209147..209797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0188"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0188"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36113"
FT                   /db_xref="GOA:Q13IH6"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH6"
FT                   /protein_id="ABE36113.1"
FT                   /translation="MRGRVSLTQPGENDVSSSSGHHRSDLDEYLGTPAACRPGECHRQA
FT                   AHRAGCLFGARRVAPAGRFDVSSSARQNPRWVDAILVQPWLLPLVRMALVSAYVIGGLA
FT                   KLANFHAAVLEQEHFGLHPGWLWAVFAIVVELGGSVCVIADRLVWLGAGGLGVLTMVAM
FT                   FVANDFWNQLGSARFMALNSFFEHLGLLAALVMATCVAGVKQSAGTAGVQKNP"
     atgcgaggtc gcgtctcctt aactcagcct ggagagaacg atgtctcaag ctcaagcgga        60
     catcatcgat cggacctcga tgaatacctc ggaacgcccg cggcttgccg accgggtgaa       120
     tgccatcggc aagccgcgca tcgtgctggc tgtcttttcg gggcgcgccg ggtggcgcct       180
     gctgggcggt ttgacgtgag cagcagcgcg cgacagaacc cgcgctgggt cgatgcgatc       240
     ctcgtccagc catggctatt gccgttggtg cgcatggcgc tggtttccgc gtatgtgatc       300
     ggcggtcttg cgaagcttgc taactttcat gccgcggtcc tggagcagga gcattttggc       360
     ctgcatcccg gctggctatg ggccgtgttc gcgatcgtcg tcgagcttgg cgggtcggtc       420
     tgtgtgattg ccgaccgcct ggtatggctg ggcgcgggcg ggctgggcgt gctgaccatg       480
     gtcgcgatgt tcgtcgccaa cgacttctgg aaccagttgg gcagtgcacg cttcatggcg       540
     ttgaactcct tcttcgagca tctcggcttg ctcgctgctc tcgtcatggc gacatgcgtt       600
     gctggcgtta aacaatccgc cggcacggcc ggtgttcaga aaaaccctta a                651
//

If you have problems or comments...

PBIL Back to PBIL home page