(data stored in ACNUC7421 zone)

EMBL: CP000272.PE187

CP000272.PE187       Location/Qualifiers
FT   CDS_pept        210820..211410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0190"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0190"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36115"
FT                   /db_xref="GOA:Q13IH4"
FT                   /db_xref="InterPro:IPR010699"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH4"
FT                   /protein_id="ABE36115.1"
FT                   /translation="MKSEDSILAAIAGYVDTLGFVALFGVFTAHVTGNFVLIGAEVAGF
FT                   GQRAFMKLMALPAFIAGVVVSSVLLRSMQGATPSRAACVLYAVQAALTLAFCLAGVGVS
FT                   PVVHADGASVIVCGMVGAAAMGVQNAHSRLVSRPGMPDTVMTGNVTQVVPDMTDMLSPQ
FT                   TPPGIKVAARARIGKILPAVLAFATGAIAGAVA"
     atgaaatccg aagacagcat actcgcggcc attgcaggct atgtggacac ccttggcttt        60
     gtcgcgctct tcggcgtgtt cactgcccac gtcaccggga acttcgtgct gatcggcgcc       120
     gaggtggccg gattcgggca gcgcgcgttc atgaagctga tggcgttgcc ggcgtttatc       180
     gcgggggtgg tggtgagcag tgttctctta aggagtatgc aaggagcgac accgagccgc       240
     gcagcatgcg ttctttatgc tgtccaggct gccttgacgc tggccttttg cctcgctggc       300
     gtcggcgtgt ccccagtcgt tcatgcagac ggtgcgtccg tcattgtctg cgggatggtc       360
     ggcgctgcgg caatgggcgt acagaatgct cacagccggc tggtgtcgcg tcccggcatg       420
     cctgacacgg tgatgacggg caacgtcacg caggtcgtgc ccgacatgac cgatatgttg       480
     tcgccgcaaa cgccacccgg gataaaggtt gccgcgcgag cgcgcatagg caagatactg       540
     ccggccgttc tggcattcgc taccggcgcg atcgcgggtg ccgtggctta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page