(data stored in ACNUC7421 zone)

EMBL: CP000272.PE188

CP000272.PE188       Location/Qualifiers
FT   CDS_pept        211753..213216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0191"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36116"
FT                   /db_xref="InterPro:IPR025388"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH3"
FT                   /protein_id="ABE36116.1"
FT                   /translation="MTWVRPKPIAGKEAVAYLSIVVAGLAFGPSDGARAETDETAAVDE
FT                   AASACTAKRPVVLFNRWQEDWSVLANPCVPRQPLDSLKYIRLGGDPDSYLSLGANLRER
FT                   LETNNALLFGIGSGHADTYLIQRAQVSADARIGQHLQFFVQLADARAFGKDAVSSVDKN
FT                   PLDLEQAFVAWVSPLGPGVVKLRIGRQEMAFDLQRFISVRDGPNVRQAYDAIWADYEYQ
FT                   KWRFIGYATQPVQYRNTTVFDDVSNRHLTFSGVRFERQEVGPGDLSGYYSRYNRSNARF
FT                   LDATGDEHRDVFDLRYTGKTGRTDWDVESMFQSGHVGTRTIGAWAVGSLAGYTLDLPGA
FT                   PRVGVQIDAASGDRHPGDGRVETFNPLFPNGYYFTLAGYTGYANLVHVKPSITLRPTSK
FT                   LSLLGALGFQWRETTADAVYQQANAVVPGTAGHGSRWTGMYVQLRADWTIASNLTGSVE
FT                   AVHFQVGDSIRNAGGSNSDYVGVEMKYGW"
     atgacgtggg tccggccgaa gccgattgca ggtaaggagg ctgttgcata tctttcgatc        60
     gtcgtcgccg gcctcgcttt cggaccaagc gacggcgcac gcgcagagac ggacgaaacg       120
     gccgcagtgg acgaggcggc gtctgcctgt accgcaaaac ggccggtggt attgttcaac       180
     cgctggcagg aggactggtc agtgcttgcc aatccatgcg tgccccggca gccgctggat       240
     agtctcaagt acatccggct gggcggcgat ccggattcgt acctgtcgct cggcgccaac       300
     ctgcgcgaac gcctcgaaac caataatgcg ctgctcttcg gtatcggctc ggggcatgcg       360
     gatacttatc tgatccagcg ggcgcaggtc agcgccgacg cgcgtatcgg ccagcacctg       420
     caattcttcg tccagctggc cgatgcgaga gcgttcggca aggacgcggt gtcttccgtc       480
     gacaagaacc cgctcgatct ggagcaggca ttcgttgcgt gggtcagccc gctggggcct       540
     ggggtggtga aattgcgcat tggccgtcag gagatggcgt tcgacctgca gcgtttcatt       600
     tccgttcgcg acggcccgaa cgtacggcag gcatacgatg ccatctgggc cgattacgag       660
     tatcagaagt ggcgcttcat cggttacgcg acgcaaccgg tgcagtaccg gaacaccacg       720
     gtgttcgacg atgtgtccaa ccggcatctc acgttcagcg gggtgcgctt cgaacgtcag       780
     gaggtcggtc ccggcgatct gtccggctac tactcgcgat ataaccgcag caatgcaaga       840
     tttctggacg caacgggcga cgaacatcgg gatgtcttcg atcttcggta cacaggaaag       900
     actggccgca ccgattggga cgtcgaatcg atgttccaga gcgggcacgt gggcaccaga       960
     acgatcggcg catgggcggt gggctcgctc gccggttata cgctggatct gccaggggcg      1020
     ccgcgggtag gcgtgcagat cgatgctgca tcaggagacc ggcatccggg cgatgggcgt      1080
     gtggagacct tcaacccgct gtttccgaac ggatactact ttacgctcgc ggggtacacg      1140
     ggatatgcca acctcgtcca cgtcaagccg tccatcacac tcaggccgac aagcaagctg      1200
     tcgttgctcg gagcgctggg attccagtgg cgcgagacga cggcagatgc cgtctaccag      1260
     caggccaacg cggtcgttcc gggcacggcc gggcatggct cgcgctggac cggcatgtat      1320
     gtgcaactga gggcggactg gacgattgct tcgaacctga ccggttcggt tgaagcggtg      1380
     catttccagg tgggggattc gatccgcaat gcgggcggca gcaattcgga ttatgtcggt      1440
     gtcgaaatga agtatgggtg gtaa                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page