(data stored in SCRATCH zone)

EMBL: CP000272.PE190

CP000272.PE190       Location/Qualifiers
FT   CDS_pept        complement(214780..215670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0194"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0194"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36118"
FT                   /db_xref="GOA:Q13IH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH1"
FT                   /protein_id="ABE36118.1"
FT                   /translation="METDMPADMIQPLCEIDDLRIGFHGHDGALTEAVRGLSLTLHRGE
FT                   RLGIVGESGSGKSLTGRALLGLLPPAAQYRAKAMTFDGQDLLSMSARKRRQLCGQQMGM
FT                   ILQDPKYSLNPVMTVAQQMREVFDLHGPKLGRREMREQIIAALAAVHIRNPERVADAYP
FT                   HELSGGMGQRVMIAMMVSSGPRLLVADEPTSALDVLVSMQVLGILDEMIEKHHTGLIFI
FT                   SHDLPLVMSFCDRVVVMFAGRVVETCAARDLVHARHPYTRGLLAASPPLIDPPDQLPVL
FT                   KPDPAWLTQPAGASA"
     atggaaactg acatgccagc cgacatgatc caacccctgt gtgaaataga cgacctgcga        60
     atcggctttc acggtcacga cggcgcattg accgaagccg tacgcggcct gtcgctgacg       120
     ctgcatcgcg gcgagcggct tggcatcgtc ggtgaatccg gttccggcaa atcgctgacc       180
     gggcgtgcgc tgctcggcct gctgccgccc gcggcacaat atcgcgcgaa ggcgatgaca       240
     ttcgatggtc aggatctgct gtcgatgtca gcgcgcaagc gccggcaact gtgcggccag       300
     cagatgggca tgatcctgca ggatccgaaa tattcgctga acccggtgat gaccgtcgcg       360
     cagcagatgc gcgaagtatt cgacctgcac ggcccgaagc tcggccgccg cgagatgcgc       420
     gaacagatca tcgcggcgct ggcagcggtg catatccgca atccggagcg cgtggccgac       480
     gcctatccgc acgagttgtc gggcggcatg gggcaacgcg tgatgatcgc catgatggtt       540
     tcctccgggc cgcgtctgct cgtcgccgac gagccgacca gcgcgctcga cgtgctcgtg       600
     tcgatgcagg tgctcggaat tctcgacgag atgatcgaaa agcaccatac cggcctcatt       660
     tttatcagcc acgacctgcc gctcgtgatg tcgttctgcg accgcgtggt cgtgatgttt       720
     gcgggacgcg tggtggaaac ctgcgcggca cgcgatctcg tccacgcgcg gcatccctat       780
     acgcgagggc tgctcgcggc gagcccgccg ctgatcgatc cgcccgatca actgcccgtg       840
     ctgaagccgg acccagcgtg gctcacgcaa ccggcaggag cgtcagcatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page