(data stored in ACNUC7421 zone)

EMBL: CP000272.PE191

CP000272.PE191       Location/Qualifiers
FT   CDS_pept        complement(215660..216574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0195"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0195"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36119"
FT                   /db_xref="GOA:Q13IH0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IH0"
FT                   /protein_id="ABE36119.1"
FT                   /translation="MNAVRRRWQDWLLSDTPASRKQAALGLAYRRWRRFAGNPLSVFGL
FT                   AILALLIIIAAIGPLIAPHDPLQQVLSDRLLPPGASSHWLGTDQLGRDILSRLIYGSRL
FT                   TLSIAILVVVIVVPVGLLIGTTAGFFGDWVDNVLMRLTDVALAFPKIVLALAFAAALGP
FT                   GVVNAVIAISITAWPAYARLARAETLRLVQADFIHVARLQGASRTRILLRYIVPLCSSS
FT                   VIVRATLDMAGIILTVAGLGFLGLGAQPPSPEWGFMVASGRNVLLDSWWVATIPGFAIL
FT                   LVSLAFNLLGDGLRDVFDPRHGN"
     atgaatgccg tgcgccggcg atggcaggac tggctgctga gcgacacccc cgcgtcacgc        60
     aaacaggccg cgctcggcct cgcttaccgg cgctggcgac gcttcgcggg caatccgctg       120
     tcggtcttcg gccttgcgat cctggccttg ctgatcatca tcgcggcaat cgggccgctg       180
     atcgcgccgc acgatccgct gcagcaagtc ctctccgacc ggcttctgcc gccgggtgcc       240
     tcgtcgcact ggctgggcac cgaccagctt ggccgcgaca tactctcgcg tctcatctac       300
     ggctcgcggc tcacgctgtc aatcgcgatt ctcgtcgtgg tgatcgtggt tccggtgggc       360
     cttttgatcg gcaccacggc tggcttcttt ggcgactggg tcgacaacgt gttgatgcgg       420
     ctcaccgacg tggcgctcgc gtttccgaag atcgtactcg cgctcgcttt cgcggccgcg       480
     ctagggcccg gtgtcgtcaa cgcggtaatc gccatttcga ttacggcctg gccggcctat       540
     gcgcgtctcg cgcgggcgga gaccctgcgg ctcgtgcaag ccgatttcat tcacgtcgcg       600
     cggttgcagg gggcgtcgcg gacgcgcatc ctcttgcgct atatcgtgcc gctgtgctcg       660
     tcgtcggtga tcgtgcgcgc gacgctcgat atggcgggca tcattctcac cgtcgcgggt       720
     ctcggattcc tcggcctcgg cgcgcaaccg ccgagccccg agtggggttt catggtcgcg       780
     tcgggccgca acgtgctgct cgattcgtgg tgggtggcca ccattccggg ctttgcgatt       840
     ctgctggtga gcctcgcgtt caatctgctc ggcgacggtc tgcgagacgt cttcgatccg       900
     cgccatggaa actga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page