(data stored in ACNUC7421 zone)

EMBL: CP000272.PE193

CP000272.PE193       Location/Qualifiers
FT   CDS_pept        complement(217765..219372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0197"
FT                   /product="ABC peptide/opine/nickel family transporter,
FT                   periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0197"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36121"
FT                   /db_xref="GOA:Q13IG8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG8"
FT                   /protein_id="ABE36121.1"
FT                   /translation="MKLVLRNVLAAAALASALTCSFTAADPAAAATPKDMFVMATFLDE
FT                   FTTLDPGEVYELVPEEYVANTYDRLVRVDLKDPSKFNGDVAQSWTVSPDGLTFTFKLRA
FT                   GLKFHSGNPLSADDVAWSIQRTVLLDKGAAAVLQGIGLTRDNVLANVKKVDDTTVSVTT
FT                   DRKYAPTFVLNVLGAWPASVVDKQLLLAHQKGNDFGNDWLRTNEAGSGAYKLVKWTAND
FT                   SLVLQRFDGYRLPLAMKRIVLRHVPEASSQRLLIENGDVDVARNLSPDDLAALTKSGKA
FT                   HVTAVPQATLLYLGLNVRNPNLAKPEVQEAMKWLIDYNGIQSNVAKTTYKVHQTFLPEG
FT                   FLGVLNTNPYQQDVAKAKALLAKAGLPNGFSVTMDVRNGYPYSEIAEAVQADLAQGGIK
FT                   VQIIPGDNKQTLAKYRSRSHDIYIGEWSADYIDPHSNAQGFAWNPDNSDKSAYKMLAWR
FT                   NSWDIPDLTKETNAALAESSTAKRAELYQTMQKQMLANSPFVILFQQVSQVAARPGVTG
FT                   LEVGPINDLVSYRDLKKQ"
     atgaaactgg tattgcgcaa tgtcctcgcg gcggcggcgc tcgcctccgc cttgacctgc        60
     tcgttcacag cggctgaccc cgctgcggcg gcgacgccga aagacatgtt cgtcatggcg       120
     acgttcctcg acgaattcac cacgctcgat cccggcgaag tctacgagct ggtgccggaa       180
     gaatatgtcg cgaatacgta tgaccggctg gtgcgggtcg atctgaagga cccctcgaag       240
     ttcaacggcg atgtcgcgca atcatggacc gtgagccccg acggcctgac gttcacgttc       300
     aagctccgtg ccggtctcaa gttccactcg ggcaatccgt tgagcgccga cgacgtcgcc       360
     tggtcgatcc agcgcacggt cctgctcgac aaaggtgcag cggccgtgct gcaaggtatc       420
     ggcctgacca gggacaacgt gcttgccaac gtgaagaagg ttgatgacac taccgtcagc       480
     gtgacgacag accggaaata cgcgccgacg ttcgtgctga acgtactcgg cgcgtggcct       540
     gcatcggtgg tggacaagca gttgctgctc gcgcaccaga aaggcaacga cttcggcaac       600
     gactggctgc gcacgaatga ggctggctcc ggcgcctata aactcgttaa gtggaccgcc       660
     aacgacagcc tcgtgctgca gcgcttcgac ggctatcgct taccgctcgc gatgaagcgt       720
     atcgtgttgc gtcatgtgcc ggaagcctcc agccagcgcc tgctgatcga gaacggcgac       780
     gtcgacgtgg cgcgcaatct gagtccggac gatctcgccg cgttgacgaa gtccggcaag       840
     gcgcacgtga ccgcggtgcc gcaggccacg cttctgtacc tcggcctgaa cgtcagaaat       900
     ccgaatctgg caaaaccgga agtccaggaa gcgatgaagt ggctgatcga ctataacggt       960
     atccagagca acgtcgcgaa aaccacctac aaggtgcacc agacgttcct cccggaaggc      1020
     tttctcggcg tgctgaacac aaacccctac cagcaggacg tcgcgaaggc caaggcgctg      1080
     ctggcaaaag ccgggcttcc gaatggcttt tccgtgacga tggacgtgcg taacggctat      1140
     ccgtacagcg aaattgccga agccgtgcag gccgatctcg cccagggcgg catcaaggtt      1200
     cagatcatcc cgggcgacaa caaacagacg cttgcgaagt accgctcgcg ttcccacgat      1260
     atctatatcg gcgaatggtc ggcggactac atcgacccgc acagcaatgc gcagggcttc      1320
     gcctggaatc cggacaattc cgacaagtcg gcctacaaga tgctcgcatg gcgcaactcg      1380
     tgggatattc ctgacctgac gaaagagacc aacgcggcgc tcgccgaatc gtcgacagcg      1440
     aagcgcgccg agctgtacca gacgatgcag aaacagatgc tcgcgaactc cccgttcgtg      1500
     atcctgttcc agcaggtctc gcaggtggcc gcgcgaccgg gcgtgacggg gctcgaagtg      1560
     gggccgatca acgacctcgt gtcgtatcgt gatctgaaga agcagtaa                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page