(data stored in ACNUC7421 zone)

EMBL: CP000272.PE196

CP000272.PE196       Location/Qualifiers
FT   CDS_pept        220526..220864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0200"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36124"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG5"
FT                   /protein_id="ABE36124.1"
FT                   /translation="MARERLITEKEAGALVERLAAQLLSSSHSLRASVCAIHQALLKPG
FT                   CSIGCWTIFTRTEQISRIYLLEILHKFCQQCAAFLQLGSVKWEVLRAHCVCCLLAGNTS
FT                   SLINLIQT"
     atggcgcgcg agcggttgat tacggagaag gaagccgggg cacttgtgga gcgcctggct        60
     gcgcaacttc tgtcttcttc tcattcgctt cgagcgtcgg tctgcgccat tcaccaagca       120
     cttttgaaac ccggctgttc catcggctgc tggaccatct tcacgcgtac agagcagata       180
     tcccgaattt atctcttaga aattcttcac aaattttgtc aacaatgcgc tgcgttccta       240
     cagttagggt ccgtgaaatg ggaagttttg cgggcgcatt gcgtttgctg tcttctggcc       300
     ggcaatacct cttccctaat taatctgata caaacttga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page