(data stored in ACNUC7421 zone)

EMBL: CP000272.PE197

CP000272.PE197       Location/Qualifiers
FT   CDS_pept        220866..224480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0201"
FT                   /product="Chitinase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0201"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36125"
FT                   /db_xref="GOA:Q13IG4"
FT                   /db_xref="InterPro:IPR002859"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IG4"
FT                   /protein_id="ABE36125.1"
FT                   /translation="MAMSKRNNAGLVRLTLIAGAVVALLHNGTSFAGSSVDAGAADNEP
FT                   ASTRQNDESTAKRKNYNLDLLPQQPSDLIYLTTVTEPDSLYLKLTFDRASLPAGGYVQI
FT                   SNGASQDVATYRAEDLLTGPVTVRGDTAVIRTVLPRLRVLGELHLSHVDYGKPAVNASV
FT                   RALIGNDERRQRACYVGTDMYRYSLPAVVAMGSGSGSVVGNGRYLLTNQHVTLGVAGKT
FT                   ESRGIELNYFRNSCDTTSEPNDPLRIRTDRIVAIGDGGSTDYSLVSLNDFDVQHAHTKE
FT                   LFGSARIRPLGDNALGDEIYIPQYGNGGLMPQVIGDLFEGKHAAVTSVGTTIKYNADTQ
FT                   SGSSGSPVLSRATNEIIALHYAGSDSANYGVRLTTLHKNVLPFIERENDNIVGEGNVKS
FT                   VALVIPPFVLGKSVGTIASGAIVAPFPDVRMTHHGAYSEALLDSQDELTLDLGAVRYQL
FT                   YFQGPAGAHDLSSQAVAGDELFIRLVPPATPSTTLSTSLAWLPLKVTDARGTLLENLIV
FT                   RVENSEYDPFTVPFDASSPDVTRLSFDIANAKKDYMLDSRFDGEQYGYVALYPGEGPAQ
FT                   LVGSTTEPYASIQLPLKNQMGRAEVVRLRGYRATACSRRAMQSTIGCASGEYSTLRLEY
FT                   LAADNPNLSAGTYDGFLPLQAQRSSATSRKILAEVHLKVASDALPVANVGESARTVVAS
FT                   SVEQTYALDGTGSRDPADEKLTYKWRVASGSFGIRNADQAKAQAVVPKNATGEGVYELT
FT                   VTNESGKTAKATVKVTAVAPQVTISGGTQQVKDNEQASYSANANFDGATYSWKLSSAAG
FT                   KQAATGSGAQWKTPVGLDAGTYTVSLDARNGAGDRSASAQQKLTVERTVALPGPEANAG
FT                   ADRTVVATNDTGFAYPLVGSASRDPNGQAITYQWRVVSGPFTLRNGDRADAEAIVPKGT
FT                   TGTGVFELKVTNAAGKTATATTKVTAIAPAVTLTGSTTVTGSGAASYKANANFEEATYS
FT                   WTLTDTSGQQVVSGSGADWNLSADVKNGNYTLKVLASSVKGQRSATATLALKVERAVAP
FT                   KPVEAKISGPVEIRAGTTIELSGAQSVNPNGTPTTYLWTVPPQLGSNAETPSVRLTAPA
FT                   NATVGAQYTIKLSVYDTQNKLSSTASYTVTVKAGETPAGPAYPAYKAGTEYKAGELVLN
FT                   YGQLYQCKPFPYAGWCSQAPPAYEPGKGWAWTDAWIKK"
     atggcaatgt ctaaaagaaa caatgccggg ctggtgaggt taacgctgat cgctggcgcc        60
     gtggtagcgc tattgcacaa tggcacgagc ttcgccggtt cgagcgtcga cgctggggcc       120
     gcggacaacg agccggcatc cacccggcag aatgacgagt ccactgcgaa gcgcaaaaac       180
     tacaatctgg atttactgcc gcagcagccg tcagatctga tttatctgac gaccgtaacc       240
     gagcccgatt ctctttatct caaactgacg ttcgacaggg cctcgctgcc cgcgggtggc       300
     tacgtccaga tctcgaacgg cgcttcacag gatgtcgcca cctaccgtgc tgaagatctg       360
     ctgaccggac cggtcacggt acgcggcgac acggcggtga tccgcaccgt cctgccgcga       420
     ctgcgcgtgt tgggggagtt gcatctcagt cacgtggact acgggaagcc ggcggtcaac       480
     gcaagtgtgc gtgccctgat cggaaatgac gagcgccgtc agcgcgcatg ttacgtgggc       540
     accgacatgt atcgctattc gctcccggca gtcgtggcga tgggcagcgg gtcgggctcg       600
     gtggtcggca acggcaggta cctgctgacc aatcagcacg tcacactggg cgtggctggg       660
     aagaccgaaa gccgtggcat cgaactcaac tatttccgaa acagctgcga taccacgagt       720
     gagcccaacg acccgttgcg catccgcact gatcgcatcg ttgcgatcgg ggatggcggc       780
     agtaccgact attcgcttgt gtcgctcaat gatttcgacg ttcagcatgc tcatacgaag       840
     gaactcttcg ggagcgcgcg tattcgcccg ctgggcgaca atgccttggg cgacgaaatc       900
     tacattcccc aatatgggaa tggggggctc atgccccagg tgatcggtga cttgttcgag       960
     ggcaagcacg cggcggtgac cagtgttggc acgaccatca aatacaacgc cgatacacag      1020
     tccggctcgt cgggttcgcc ggtcttatcg cgcgctacca atgagattat cgcgctgcat      1080
     tatgctggca gcgatagcgc aaactatggt gtacgcctga ccacactcca caaaaacgtc      1140
     cttccgttca tcgagcggga aaacgacaac attgtcggcg aaggcaatgt gaagtcggtc      1200
     gcgctggtca ttccgccttt tgttcttggc aagtcggtgg gtaccatcgc atcgggcgct      1260
     atcgtcgcgc ccttcccgga tgtccggatg actcaccacg gtgcgtattc cgaagccctg      1320
     ctcgatagtc aggacgagtt gaccctggac ctcggcgccg tacgctatca gctttacttc      1380
     cagggcccag ccggtgccca tgatctgtcg tcgcaggcgg ttgcgggtga tgaactcttt      1440
     atccgtctgg tcccgccggc gacaccgtca acgacgttgt ccacgtcgct ggcatggttg      1500
     ccgctgaagg ttaccgacgc ccggggcacg ctactggaaa acctgatcgt gcgggtggag      1560
     aattccgaat atgatccctt caccgtaccg ttcgatgcca gctcgcccga cgtgacccgg      1620
     ctgagtttcg acatcgcgaa tgcgaaaaaa gactacatgc tcgacagtcg cttcgacggc      1680
     gaacagtacg gctatgtcgc gctctatccg ggtgaagggc cggcgcaact ggtcggctcc      1740
     acgacggagc cgtatgcgtc gatccagctg cctttgaaga atcagatggg cagagcggag      1800
     gtcgtgcgct tgcgcggcta tcgcgctacc gcttgctcac gccgcgcgat gcagtcgacg      1860
     attggctgtg ccagcggtga gtacagcaca ttgcggctgg aatacctggc ggccgacaat      1920
     cccaatctgt ccgcgggtac ttacgatggg tttttgccct tgcaggccca gaggagcagc      1980
     gccacgagca ggaagattct cgcagaggtc catctgaagg tggcgagtga tgcgctgccc      2040
     gtagctaatg tgggcgagag cgcgcgtaca gtcgtcgcga gcagcgttga acagacctat      2100
     gcgctggacg ggacgggcag ccgcgacccg gcggacgaaa agctgaccta taaatggcgt      2160
     gtggcaagcg gatcgttcgg cattcgcaat gcggatcagg ccaaggccca ggcggtcgtg      2220
     ccgaagaatg cgacgggtga gggcgtctat gagctgaccg tcacgaacga gtcgggcaag      2280
     acggcgaagg cgacggtcaa ggtcaccgcg gtggcgccgc aggtcacgat cagcggcggt      2340
     acgcagcagg tgaaggacaa cgagcaggcg agctacagcg cgaatgcgaa cttcgacggc      2400
     gcgacctact cctggaagct gtccagcgct gccggcaagc aggcggcgac gggtagcggg      2460
     gcgcaatgga aaacgccggt gggtctggat gcgggcacgt acacggtgtc gcttgacgca      2520
     cgtaacggcg ccggcgaccg gagcgcgagc gcgcagcaga aactgaccgt tgagcgcacg      2580
     gtagcgcttc ccggaccgga ggccaacgcg ggcgcggacc gcacggtggt ggcgacgaac      2640
     gacaccgggt ttgcgtatcc gctcgtcggc agcgcaagtc gcgacccgaa cgggcaggcg      2700
     atcacgtatc aatggcgcgt ggtgtcgggc ccgttcacgt tgcgcaacgg tgatcgtgcc      2760
     gatgcggagg cgatcgtacc gaagggcacc accggcacgg gcgtgttcga gctgaaggtg      2820
     acgaacgcgg cgggcaagac ggcgacggcg accacgaagg tgaccgcgat cgcgccggcc      2880
     gtgacgctca cgggcagcac gaccgtgacc ggcagcgggg cagccagcta caaggcgaac      2940
     gcgaacttcg aggaagcgac ctatagctgg acgctcaccg atacgtcggg ccagcaggtc      3000
     gtatcgggca gcggtgcgga ttggaacctg tccgctgacg tgaagaacgg caactacacg      3060
     ctcaaggtgc tcgcatcgag cgtcaagggg cagcgtagcg cgacggcgac cctggcgctg      3120
     aaggtggagc gcgcggtggc gcccaagccg gtggaggcca aaatcagcgg tccggttgaa      3180
     atcagggcgg gcacgaccat cgagctttcc ggagcgcaat cggtcaaccc gaacggtacg      3240
     ccgaccactt acttgtggac cgtgccgccg cagctgggct cgaatgccga aacgccgagc      3300
     gtccggttga cggcgcctgc caatgccaca gtgggcgcgc agtacaccat caagctgtcg      3360
     gtgtacgaca cgcagaacaa gctgtccagt acggcgagct acacggtgac ggtgaaagcc      3420
     ggcgaaacac cggccggccc agcctatccg gcctacaagg cgggtacgga gtacaaggct      3480
     ggtgagctgg tgctcaacta cggtcagctc tatcagtgca agccgttccc gtacgccggc      3540
     tggtgcagtc aggcgccgcc cgcctatgag ccgggtaaag gctgggcatg gacggatgcc      3600
     tggatcaaga agtaa                                                       3615
//

If you have problems or comments...

PBIL Back to PBIL home page