(data stored in ACNUC7421 zone)

EMBL: CP000272.PE2

CP000272.PE2         Location/Qualifiers
FT   CDS_pept        1472..2221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0002"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0002"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35930"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J09"
FT                   /protein_id="ABE35930.1"
FT                   /translation="MAISPEAEKSKVISTPWTARILNVEASNSADLPAGWRDAYRSYRE
FT                   TLDRPDYPCFFGQAAERRGEMFYAFDGERPDVARMTMRRFVELGRDAALARHSLAMFCT
FT                   PDPALVSHAEFLRRFWYILRQLHEADDMPMRPADPDDPLWEFSFGGRKMFVVGTGPTYR
FT                   RRRSRVVGNGIVLLFQPRELFTDPTTGKPISAEVRRQIHARMLAYDAMPVHPDIGFYGD
FT                   PRNREWKQYCLPDDNTPVTGRCPFASR"
     atggcgattt cccccgaagc cgagaagtcg aaagtgatat ccaccccctg gaccgcccgg        60
     atcctgaacg tcgaagcgtc gaattccgcc gatctgcccg cgggctggcg cgatgcgtat       120
     cgcagctacc gcgaaacgct cgaccggccg gattatccgt gcttcttcgg ccaggcggcc       180
     gagcgccgtg gcgagatgtt ctacgcattc gacggcgagc gtcccgacgt tgcacgtatg       240
     acaatgcggc gcttcgtcga gctcgggcgc gatgcggcgc tcgcgcgcca tagtctcgcc       300
     atgttctgca cgccggaccc tgcgctcgtg tcgcacgccg aattcttgcg gcgcttctgg       360
     tacatactgc ggcaactgca cgaggccgac gacatgccga tgcggcccgc cgatccggac       420
     gacccgttgt gggagttctc gttcggcggt cgcaagatgt tcgtggtcgg caccggtccg       480
     acctatcgcc ggcggcgcag ccgtgtggtc ggcaacggga tcgtgttgct gttccagccg       540
     cgcgagctgt tcaccgaccc gacgaccggc aagccaatca gcgccgaagt gcgccgccag       600
     atacatgcca ggatgctggc gtacgacgcg atgccggtgc atccggacat tggcttttac       660
     ggcgatccgc gcaatcggga atggaagcag tattgtttgc ccgacgacaa tacgccggtt       720
     accgggcgtt gcccgttcgc cagccgctga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page