(data stored in ACNUC7421 zone)

EMBL: CP000272.PE202

CP000272.PE202       Location/Qualifiers
FT   CDS_pept        228807..229277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0206"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0206"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36130"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF9"
FT                   /protein_id="ABE36130.1"
FT                   /translation="MNSSQDLQLLGRGFYWQEIHAGQRFRTFRRTVTESDLVNFISATG
FT                   MLEAIFIDADYEHGAMRGRPVPAALTSGLIEGLLFQTMVQGTGLALLEFSMKTHGPVVV
FT                   NDAIYGIVEVDEVKPTSKNNRAVVTSHVDVLNQRDERVLSYTAKRLLAGRPE"
     atgaattcat cgcaggatct gcaactgctc ggccgtggtt tttactggca ggaaattcac        60
     gcgggtcaac gctttcgcac gttccggcgt acggtcaccg agagcgacct ggtcaatttc       120
     atttcggcta ccggcatgct ggaagccatc tttatcgatg ccgattatga acatggcgcg       180
     atgcgcggcc ggcccgtgcc cgccgcgttg accagcggac tgatcgaggg tctgctgttt       240
     cagacgatgg tgcagggcac cggcctcgcg ttactcgaat tttcgatgaa aacgcatggg       300
     ccggtggtcg tcaacgatgc catctacggg atagtcgaag tcgatgaagt gaagccgacc       360
     tcgaaaaaca accgcgcggt cgtcacgagc cacgtcgacg tgctcaatca gcgtgacgag       420
     cgggtgctct cgtacacggc aaagcgtctg cttgccggtc gccccgaata a                471
//

If you have problems or comments...

PBIL Back to PBIL home page