(data stored in ACNUC7421 zone)

EMBL: CP000272.PE206

CP000272.PE206       Location/Qualifiers
FT   CDS_pept        232332..232589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0210"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36134"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IF5"
FT                   /protein_id="ABE36134.1"
FT                   /translation="MAGAERLFQVLIATLDAPAHFSCFACTAARSKARRSFKADRVDER
FT                   VATHRYPGAYCAMSASVHLLRPATIKKTHRHVWQEKDACP"
     atggccgggg ccgaacggct gtttcaggtt ctgatagcca cgctcgatgc gcctgcacat        60
     ttttcctgtt tcgcctgcac ggcggcgcga tcaaaagcgc gcagatcctt caaggccgat       120
     cgcgtcgatg aacgggtggc aacacatcga tatccaggcg cttactgtgc gatgagcgca       180
     tccgtgcatc tcctccggcc agcgacgata aaaaagacgc accgccacgt ttggcaggaa       240
     aaggacgcgt gcccctaa                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page