(data stored in ACNUC7421 zone)

EMBL: CP000272.PE21

CP000272.PE21        Location/Qualifiers
FT   CDS_pept        28889..29749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0022"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0022"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35949"
FT                   /db_xref="GOA:Q13IZ0"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IZ0"
FT                   /protein_id="ABE35949.1"
FT                   /translation="MNDRQDIAPDSTAARVALWRALHVELDPPPHVMEDEIGLQLLAPG
FT                   EDWRHRGDMDPRFTRPFRASIVARARFVEDLVVEQAGRGLTQYVILGAGLDSFAQRRPE
FT                   IASRLRVFEIDRPGPQAWKRQRLVELGFGMPDWLRFVPVDFGAGQGWRGGLATAGFDDS
FT                   KPAIVVSTGLSMYLTRDANAATLREVAALAPGSTLAMTFLLPLERADPELRPALEMAEK
FT                   GARAGGTPFLSFFTPAELVALAHQSGFGEARHVSAADLTRRYFADRTDGLRPPNNAEEL
FT                   LVAKT"
     atgaacgaca ggcaagacat agcgccagac agcacagccg cgcgagtcgc attgtggcgt        60
     gctctgcacg tcgagctcga cccgccgcca cacgtgatgg aggacgaaat cggccttcaa       120
     ctgctcgctc cgggcgaaga ttggcgccat cgcggcgaca tggacccgcg gttcacgcgt       180
     cccttccggg cgtccatcgt ggcgcgcgcg cgcttcgttg aagacctggt cgtggagcag       240
     gccggccgcg gacttacgca gtatgtcatt ctcggcgccg gccttgacag cttcgcacaa       300
     cgcaggccgg agatcgcatc ccgtctccgg gtgttcgaga tcgaccgtcc gggtccgcag       360
     gcatggaagc gtcagcgtct ggtcgagctg ggtttcggca tgccggactg gctgcgtttc       420
     gtgccggtcg atttcggggc cggacagggc tggcgcggcg ggctcgcaac cgctggcttc       480
     gacgacagca agccggccat cgtcgtttcc accggcctca gcatgtatct cacgcgggat       540
     gcgaacgcgg ccacgctgcg cgaggtcgcg gcgcttgccc cgggatcgac gcttgccatg       600
     accttcctgc tcccgctgga gagggcggac cccgaactgc gtcccgcgct ggaaatggcg       660
     gagaagggcg cgcgagcggg cggcacacct ttcctgagct tcttcacgcc ggcggagttg       720
     gtggcgcttg cccaccaatc cggctttgga gaagcacggc acgtgtcggc tgccgatctc       780
     acccggcgct acttcgcgga caggacagat ggtctgcgtc cgccgaacaa tgcggaggag       840
     ctgctggtgg cgaagacctg a                                                 861
//

If you have problems or comments...

PBIL Back to PBIL home page