(data stored in ACNUC7421 zone)

EMBL: CP000272.PE212

CP000272.PE212       Location/Qualifiers
FT   CDS_pept        236965..238005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0216"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0216"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36140"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE9"
FT                   /protein_id="ABE36140.1"
FT                   /translation="MLEAWKTVLSLSNLQPGQTVTVLTGATSHPQSVSTALTAATAMRA
FT                   VVNRLDLQPINGEKALSRDSLAYLGTTPLTGNRAAIAALSASDIVLDLMTLLFSPEQHE
FT                   ILKSGAKILLAVEPPEVLVRMVPSVEDRGRVKAAADRLARAKLMQVRNDAGTDLLCPLG
FT                   QYPAISEYGFVDEPGRWDHWPSGFALTWPNEGETQGTIVLSPGDILLPQKSYIRSEIRL
FT                   VMKDGFAVSIEGGMDADLLSEYMASFEDPEAYAMSHIGWGLQPRAHWSTLGLYDREATL
FT                   GMDARAFEGNFLFSLGPNNEAGGTRTTACHIDIPMRNCTVTLDGEPVVTRGKVHAQQPG
FT                   SQKTHA"
     atgctcgaag catggaaaac agttctcagc ctgtcgaacc tccaacccgg tcagacggtt        60
     accgtcttga caggcgccac cagtcacccg caatccgtgt cgacggcgct gaccgccgcg       120
     accgccatgc gcgccgtcgt caatcgcctc gacctgcagc ccatcaatgg cgaaaaggcg       180
     ctcagccgcg attcgcttgc ctatctcggc accacgcctc tcacgggtaa ccgcgctgcc       240
     attgccgcgc tcagtgcaag cgacatcgtg cttgatctga tgacgcttct gttttcgccg       300
     gaacagcacg agatcctgaa aagcggcgcg aagattctgc tcgcagtgga gccgccggag       360
     gtgctcgtgc gcatggtacc gtcggtggaa gaccgcggcc gcgtaaaggc ggcggcagac       420
     aggcttgcgc gggcgaaact catgcaggtg cgcaacgacg ccggcactga tctgctgtgt       480
     ccgctcgggc aatatccggc catcagcgaa tatggtttcg tcgatgaacc cggacgctgg       540
     gaccactggc caagtggctt cgcgctgacc tggcccaacg agggcgagac gcaaggcacg       600
     atcgtgctgt cgccgggcga tatcctgctg ccgcagaaat cgtatatccg ttccgaaatc       660
     cggctggtga tgaaagacgg cttcgctgtg tcgatcgagg gcggtatgga tgccgatctg       720
     ctgtccgaat acatggcgtc gttcgaggat cccgaggcct acgcgatgtc gcacatcggc       780
     tggggacttc agccgcgcgc tcactggtcg acgctcggtc tgtacgaccg tgaagcgacg       840
     cttgggatgg atgcgcgcgc attcgagggc aattttctgt tctcgctcgg tccgaacaat       900
     gaggcaggcg gcacacgcac caccgcatgc cacatcgaca ttccaatgcg caattgcacg       960
     gtgacgctcg acggcgaacc cgtcgtgacg cgtggcaagg tgcatgcaca gcaaccaggg      1020
     agccagaaga cccatgcata g                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page