(data stored in ACNUC7421 zone)

EMBL: CP000272.PE213

CP000272.PE213       Location/Qualifiers
FT   CDS_pept        237998..238633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0217"
FT                   /product="isochorismatase hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0217"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36141"
FT                   /db_xref="GOA:Q13IE8"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE8"
FT                   /protein_id="ABE36141.1"
FT                   /translation="MHSEVETYRRQGFGNTLQPRAPFGLLIVDFVNGFADPAVFGGGNI
FT                   AAAIGNTRPVLAAARRRQWPVAHTRIVFADDDADSNIFALKVPGMLTLKERDHNSAIVD
FT                   ELAPQSGEMVVRKTVPSAFFGTSLAAWLAQRGVQTLIVAGAVTSGCVRASVVDAMQYGF
FT                   RPVVLSDCVGDRAIAPHEANLFDMEQKYAAVMESCVLLDLVAGSEAAA"
     atgcatagcg aagtggaaac ctatcgcaga caagggttcg gtaacacgct gcagccgcgt        60
     gcgcctttcg gcctgcttat cgtggacttc gtcaacggat tcgccgaccc ggccgtgttc       120
     ggcggcggca acatcgccgc agccatcggg aatacgaggc cagtcctcgc ggcggcgcgg       180
     cgcaggcaat ggccggttgc gcatacgcgt atcgtgtttg cggacgacga cgccgacagc       240
     aatattttcg cgctgaaggt tccaggcatg ctgacactca aggagcgaga tcacaacagt       300
     gcgatcgtcg acgaactggc cccgcagtcc ggcgagatgg tggtccgcaa gacggtgcca       360
     tccgcgttct tcggcacgtc cctcgcggcg tggcttgcgc agcgcggcgt gcaaacgctg       420
     atcgtcgcgg gcgcggtaac cagcggctgc gtgcgcgcaa gcgtcgtcga tgcaatgcag       480
     tacggtttcc gcccggtggt gttgtccgac tgcgttggcg accgcgcaat cgcaccgcac       540
     gaagccaacc tgttcgacat ggagcagaaa tacgcggcgg tcatggagtc gtgcgtgctg       600
     ctcgatctcg tcgcgggcag tgaggcggcg gcgtaa                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page