(data stored in ACNUC7421 zone)

EMBL: CP000272.PE219

CP000272.PE219       Location/Qualifiers
FT   CDS_pept        243932..244657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0223"
FT                   /product="amino acid/amide ABC transporter ATP-binding
FT                   protein 2, HAAT family"
FT                   /note="TC 3.A.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0223"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36147"
FT                   /db_xref="GOA:Q13IE2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IE2"
FT                   /protein_id="ABE36147.1"
FT                   /translation="MNASAQPVLTVSDIHVAYGKTKALHGVSLEVACGEVIALIGANGA
FT                   GKSTMLRAISGLLPLSAGAIHWNGNSIGGLAADRIVASGIAHCPEERHVWPAMTVLENL
FT                   SLGAYLCRSREVVARRTELAFERFPRLRERSSQLAGTLSGGEQQMLAIARALMSEPRLL
FT                   LLDEPSLGLSPKVAHEILDVIRAINEHGVTVLLVEQNVHNALSVAKRAYVFETGQIAAT
FT                   RTAEELLGDNELLAAYLGG"
     atgaacgcat cggcacaacc tgttctgacc gtctcggaca ttcacgtcgc ctatggcaaa        60
     accaaggcgt tgcacggcgt ttcgctggag gtcgcgtgcg gcgaagtgat cgcgctgatc       120
     ggcgcgaacg gcgcgggaaa gagcaccatg ctccgggcta tctccggtct gctgccgttg       180
     agcgccggcg cgatccactg gaacggcaat tcgatcggcg gcctcgcggc cgaccggatc       240
     gtcgcgtccg gcatcgccca ttgcccggaa gagcggcatg tctggcccgc gatgacggtg       300
     ctggaaaatc tgtcgctggg cgcgtatctg tgccggtcgc gcgaagtggt cgcgcgacgc       360
     acggagcttg cgttcgagcg ttttcccagg ttgcgtgaac ggtcgtcgca acttgccggc       420
     acgttaagcg gcggcgaaca gcaaatgctc gcaatcgcgc gggcgcttat gtcggaaccg       480
     cgccttctcc tgctcgacga accgagcctc ggcttgagtc cgaaggtcgc gcacgaaatt       540
     ctcgacgtga tccgcgcgat caacgagcat ggcgtgacgg tgctgctcgt ggagcagaac       600
     gtgcacaacg cgctgtcggt cgcgaagcgc gcctatgtgt tcgagaccgg ccagatcgcc       660
     gcgacgagaa ccgccgaaga actgctgggc gataatgaac tgcttgctgc gtatctggga       720
     ggctag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page