(data stored in ACNUC7421 zone)

EMBL: CP000272.PE223

CP000272.PE223       Location/Qualifiers
FT   CDS_pept        complement(246319..247146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0227"
FT                   /product="outer membrane transport energization protein
FT                   TonB"
FT                   /note="TC 2.C.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0227"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36151"
FT                   /db_xref="GOA:Q13ID8"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ID8"
FT                   /protein_id="ABE36151.1"
FT                   /translation="MNSTTLLFPSTRRRYRLAALRPAMPAGPFVHDVNVLIPPSLALGD
FT                   RRHPLRFRTLWAVLLVAVAAHLALIHALHAARSHAPHTPVKLPPVRIELVTPPKPLPEA
FT                   PTPPPPSPAPAKTPPRVTHAAPMARAVRPPPVAAPRPARPELPATPSDVPLAPAPTAVP
FT                   APPAAPAPAALAPAPAEAKVVPPNGSAAYLHNPPPDYPPMARDQGWEGHVVLSVHVLAN
FT                   GHPDSVEVRTSSGRKVLDRAAVNAVTNWIFAPARRGDTPIDGWVDVPLDFKLG"
     atgaattcaa cgacgctcct tttcccatcg acccgccgtc gctaccgcct cgcggcgctc        60
     cggccggcga tgcccgcggg gcccttcgtg cacgacgtca acgtgctgat accgccgtcg       120
     ctcgcgctgg gcgaccggcg ccatccgctg cgcttcagga cattgtgggc ggtgctgctc       180
     gtcgcggtcg cggcacatct cgcgcttatc catgcgctgc atgccgcgcg cagccacgca       240
     ccacacacgc ccgtgaagct cccgccggtc aggatcgaac tggtcacgcc gcccaaaccg       300
     cttcccgaag cgcccactcc tccgcctccg tcacccgcgc cggcgaaaac accgcctcgc       360
     gtcacccatg ccgcgccaat ggcgcgcgcg gtgagaccac ccccggttgc cgcgccacgt       420
     ccggcgaggc cggaactgcc tgccacgccg agcgatgtgc cgcttgcccc agcgcccacg       480
     gcggtacccg cgccgccagc cgcgcccgcg cctgcggcgc tcgcccctgc gccggccgaa       540
     gcgaaggtgg tgccgccgaa cggctcggcc gcgtatctgc acaatccgcc acccgactat       600
     ccgccgatgg ctcgcgatca aggctgggaa ggacatgtcg tactgtccgt ccatgtgctc       660
     gcgaacggcc atccagacag cgtggaggtc cgtacgtcga gcggccgcaa ggtgctggat       720
     cgcgctgcgg tgaatgccgt gaccaactgg attttcgcgc cggccagacg cggcgatacc       780
     ccgatcgacg gctgggtcga cgtaccgctc gatttcaaac ttggctga                    828
//

If you have problems or comments...

PBIL Back to PBIL home page