(data stored in SCRATCH zone)

EMBL: CP000272.PE23

CP000272.PE23        Location/Qualifiers
FT   CDS_pept        30904..32124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0024"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0024"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35951"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY8"
FT                   /protein_id="ABE35951.1"
FT                   /translation="MDSLITAAARALAAGDPLGALDRIALRDDAPALALRGIAMAQLGD
FT                   LVRAKALVRSAARAFGADGAVARARCIVAEAEIALASRELGWPAKALDAARATLEAHGD
FT                   RLNAAHARYLEVRRLALVNRLREAEQTLAGLAPALLPPALRAVHELAVAELALRRLRTK
FT                   AARTALARAARAARRAGIPALTAEVEHASLVLSTPAARLIAHGEERLLLLDEVEALLAS
FT                   RGLVVDACRHAVRDADTVISLASRPVLFALARALGEAWPDDVPRDTLVARAFRARRADE
FT                   SYRARLRVEIGRLRAELGTLAGVSATRRGFALTPRGPAEVVVLAPLVEGEHAQVLAFLA
FT                   DGESWSSSALALVLGASQRTVQRALDSLATAGKVQSFGRGRARRWITPPVPGFATTLLL
FT                   PTFLSDD"
     atggactcgc tgatcacggc cgcggcgcgt gcgctcgcgg cgggtgatcc gctcggcgca        60
     ctggatcgca tcgcgctgcg cgacgacgcg cccgcgctcg cgcttcgcgg tattgcgatg       120
     gcacagctcg gggatctcgt gcgcgcgaag gcgctcgtgc gaagcgcggc gcgcgcgttc       180
     ggtgcagacg gtgctgtggc ccgcgcgaga tgtatcgtcg ccgaggcgga gatcgcgctc       240
     gcgtcgcgcg agctgggctg gcccgcgaag gcgctcgacg ccgcgcgggc gacgctcgaa       300
     gcgcacggcg accgcctgaa cgccgcgcat gcgcggtatc tggaggttcg gcgcctcgcg       360
     ctggtcaatc gtctccgcga ggccgagcaa acgcttgccg ggctcgcgcc cgcgctgctg       420
     ccgcccgcgc tgagggcggt ccatgaactg gctgtcgcgg aactcgcatt gcgccgcctg       480
     cggacgaagg cggcccgcac ggcgctcgcc cgggccgcgc gcgccgcgcg ccgcgcgggc       540
     atcccggcgc tgacggcgga ggtcgagcac gcatcgctcg tgctgagtac gccggcggcg       600
     cgtctgattg cgcacggcga ggaaaggctc ctgctgctcg acgaggtgga ggcgttgctg       660
     gcgtcgaggg ggctcgtcgt ggatgcgtgc cgtcatgccg tgcgtgacgc ggatacggtg       720
     atttctctcg ccagccgtcc ggtgctgttc gcgctggccc gtgcactggg tgaagcgtgg       780
     cccgacgacg tgccgcgaga caccctcgtc gcgcgggctt tccgggccag gcgcgccgac       840
     gaatcgtatc gcgcgcgctt gcgggtcgaa atcgggcggc ttcgcgctga actcggaacg       900
     ctagcgggcg taagcgcgac gaggcgcgga tttgcgctga cgccgcgcgg gccagccgag       960
     gttgtcgtgc tggcgcctct cgtggaaggg gagcatgcac aggtgctcgc cttccttgcc      1020
     gacggcgagt cgtggtcgag ttccgcgctc gcgctggtgc tcggcgcgag ccagcgcacc      1080
     gtgcaacgcg cactcgactc gctggcgaca gcgggcaagg tgcagtcgtt cggccgcgga      1140
     cgagcgcgtc gttggatcac tcccccggta ccgggattcg cgacgacctt gttactcccc      1200
     actttcctat ccgacgatta g                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page