(data stored in ACNUC7421 zone)

EMBL: CP000272.PE233

CP000272.PE233       Location/Qualifiers
FT   CDS_pept        258974..259792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0237"
FT                   /product="ABC sulfate ester transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0237"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36161"
FT                   /db_xref="GOA:Q13IC8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC8"
FT                   /protein_id="ABE36161.1"
FT                   /translation="MNELANVARTVSAGTGARRWTRFRRGVILPLVLGITWWAVYAFGW
FT                   AHSRMFVPPAQVIRTGLAMSFDGELPGAWLASLGRDLLGLAIGSLCGFGFALFLKSARW
FT                   IDAAIAPTFHAIRQVALFAWIPLLGTWFGLGEVGKVVFISLAAFFPVWLNAAQGLEAVP
FT                   RHYDELADVFRFTRWQRFRRIVLPAIVPSLFNGFYLALVTSWIATLGAELLMTSGVGIG
FT                   TVLNDGRENFRMDQVLLGVAVVGLTGFAFHSFAAGIDSRLARRRGAGARP"
     atgaacgagc tggcaaacgt cgcgcgcacg gtgtcggcgg gaacgggtgc gcgccgctgg        60
     acccgatttc gacgcggtgt catcctgccg ctcgtgctgg gcatcacatg gtgggcggtc       120
     tatgcattcg gctgggcgca ctcgcggatg ttcgtgccgc cggcgcaggt tatccgcacc       180
     ggactcgcca tgtcgttcga cggcgaattg ccgggcgcgt ggctggcgag cctcggccgc       240
     gatctgctag gactggcgat cggttcgctg tgcggcttcg gcttcgcgct gttcctgaaa       300
     agcgcacgct ggatcgacgc ggcgattgct ccgaccttcc acgcgatcag gcaggtcgcg       360
     ttatttgcgt ggatcccgtt gctcggcacc tggttcggtc tcggcgaggt gggcaaggtg       420
     gtcttcatct cgctcgctgc gttttttccc gtgtggctga atgcggcgca aggactcgaa       480
     gccgttccgc gacattacga cgagctggcc gacgtatttc ggttcacacg ctggcagcgc       540
     ttccggcgca tcgtgttgcc ggcgatcgtg ccgtcgcttt tcaacggctt ctatctggcg       600
     ctcgtcacct catggatcgc caccctcggc gccgagcttc tgatgacctc gggcgtcggc       660
     attggcaccg tgctgaacga cgggcgcgag aacttccgta tggatcaggt tctgctcggt       720
     gtcgcggtgg tcggcctgac cggcttcgcc ttccattcat tcgcggcggg catcgacagc       780
     cgcctcgcgc gacgacgcgg cgccggggca cgaccatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page