(data stored in ACNUC7421 zone)

EMBL: CP000272.PE235

CP000272.PE235       Location/Qualifiers
FT   CDS_pept        260720..261289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0239"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0239"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36163"
FT                   /db_xref="GOA:Q13IC6"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IC6"
FT                   /protein_id="ABE36163.1"
FT                   /translation="MTLDARILILPGRGSSGSDHWQSHWEAANPHYLRVQQDEWDSPVL
FT                   DAWLPRLNAAIQAEAVPALLVAHSLSVSLVAHWASRYSGPVAGALLVAPSDVEAPSYPA
FT                   GTSGFAPLPLRPLGFPAIVVASTDDPRVSVERARQFADAWGARFVLAGAYGHLGSASRL
FT                   EDWPFGQLRLAELAKLAGVTLPVNAA"
     atgacgctcg atgcccgcat tctcattctg ccaggccgtg gcagctccgg ttctgatcac        60
     tggcaaagcc attgggaagc ggccaatccg cactatctcc gcgtgcagca ggacgagtgg       120
     gacagtcccg ttctcgacgc atggctgccg cgcctgaacg cggcgattca ggcggaggcg       180
     gttcccgcgc tgctggttgc acattcgttg tcggtgtcgc tggtcgcgca ctgggctagc       240
     cgttactcgg ggccggttgc cggcgcgctg ctggttgcgc cgagcgacgt ggaggcgccc       300
     agctatccgg ccggcacctc cggcttcgcg ccattgccgc tgcggccgct cggttttccg       360
     gcaatcgtgg tcgccagtac cgacgatccg cgcgtgagcg tcgagcgagc ccggcagttc       420
     gccgacgcgt ggggggcgag gttcgtattg gccggcgcct acgggcacct cggctccgcg       480
     tcgcggctgg aagactggcc gttcggtcag ctacggctgg ctgagctggc gaagctcgcc       540
     ggggtgacat tgcccgtcaa cgcggcctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page