(data stored in ACNUC7421 zone)

EMBL: CP000272.PE246

CP000272.PE246       Location/Qualifiers
FT   CDS_pept        273002..273751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0250"
FT                   /product="Electron transfer flavoprotein beta-subunit,
FT                   EtfB"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0250"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36174"
FT                   /db_xref="GOA:Q13IB5"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB5"
FT                   /protein_id="ABE36174.1"
FT                   /translation="MKVVVAVKRVVDYNVKVRVKADGTGVDIANVKMSMNPFDEIAVEE
FT                   AVRLKEAGVATEVIAVSAGVTQAQETLRTALAIGADRAILIESNEELQPLAVAKLLKAL
FT                   VDREQPSLVILGKQAIDDDSNQTGQMLAALANLPQATFASKVVVADGKATVSREVDGGA
FT                   ETLSLTLPAVVTTDLRLNEPRYVTLPNIMKAKKKPLEVVKPEDLGVDVTPRLKTLKVVE
FT                   PPKRPAGVKVPDVQTLVGKLKTEARVL"
     atgaaggttg tggtggcagt caagagagtg gtcgattaca acgtgaaagt ccgggtgaaa        60
     gcggacggca cgggcgtcga tatcgcgaac gtgaagatgt cgatgaaccc gttcgatgaa       120
     atcgcggttg aagaagcggt gcgtctgaag gaagcgggcg tggcgaccga agtgatcgcg       180
     gtgtcggcgg gtgtgacgca ggcgcaggag acgctgcgca cagcgctggc gatcggcgcg       240
     gaccgcgcga tcctgatcga gtccaatgaa gagttgcagc cgctggccgt ggccaagctg       300
     ctgaaggcgc tggtcgacag ggaacagcct tcgctcgtca ttctcggcaa gcaggcgatc       360
     gacgacgatt cgaaccagac cgggcagatg ctggccgcgc tggcgaatct gccgcaggcg       420
     acgtttgcgt cgaaggtagt cgttgctgac ggcaaggcga cggtgtcgcg cgaagtggac       480
     ggcggtgcgg agacgctgtc gctgacgctg cctgcggtcg tcaccaccga cctgcgcctg       540
     aacgagccgc gttatgtgac gctgccgaac atcatgaagg caaagaagaa gccgctggaa       600
     gtggtcaagc ctgaagacct cggtgttgac gtcacgccgc gcctgaagac gctgaaagta       660
     gtcgagccgc cgaagcgccc ggccggcgtg aaggtgccgg atgtgcagac gctggtcggg       720
     aagctgaaga ccgaagccag ggtgctttag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page