(data stored in SCRATCH zone)

EMBL: CP000272.PE249

CP000272.PE249       Location/Qualifiers
FT   CDS_pept        275711..276808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0253"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0253"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36177"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB2"
FT                   /protein_id="ABE36177.1"
FT                   /translation="MAEPQHTASGTVAELTYPFAGPPAPGQTREVAPGVLWIRMPMPLA
FT                   LDHINLWAIADGAGWTVVDTGLRNAGTAEVWERLFEEALGGRPVTRVIVTHMHPDHIGM
FT                   AGWLTRRFNCRLWMTRLEYLHCRVLVADNGREAPPDAIRFLRGAGWDDSAIEGYRARFG
FT                   NFGKGTYALPDSYRRLRDKEVIRIGQHDWAVVVGNGHSPEHACLWSPELKLLISGDQVL
FT                   PRISSNVSVHPIEPDADPMSDWLMSLKKIAGNVPDDVLVLPGHNECFHGLHARLAGLAA
FT                   GQDAAFERLRAALAKGPGRVVDVFPALFRRPITGSDAQLLGLATGESQACLNYLLYRGE
FT                   ISVDVDADGVRWYSLCEPGSEASGS"
     atggcagaac cacaacacac cgcgtccggc accgtcgctg agctgactta tccgttcgcg        60
     gggccgccag cacctggcca gacgcgggaa gtagcgccgg gcgtgctatg gatccggatg       120
     ccgatgcctt tggcgcttga tcacatcaat ttgtgggcga ttgcggatgg cgcgggctgg       180
     accgtcgtcg ataccggctt gcgcaatgcg ggtacggcag aagtgtggga gcgtttgttc       240
     gaagaggctt taggaggccg tccggtcact cgggtcatcg tgacgcacat gcatccggat       300
     cacattggca tggcaggatg gcttacgcgc aggtttaact gccggctatg gatgacgcgt       360
     ctcgaatacc tgcactgcag ggtgctggtc gcagacaacg gccgggaagc tccacctgat       420
     gcgatcaggt tcctgcgcgg tgcgggatgg gacgactcgg caatcgaggg ttatcgcgca       480
     cgcttcggca atttcgggaa gggcacctat gcgttgccag acagctatcg ccggttgcgc       540
     gacaaggagg tgatacgcat tgggcaacac gattgggccg tggtggtggg taatggccac       600
     tcgcccgaac acgcatgttt gtggtcgcca gaactgaagc tgctcatttc gggtgaccag       660
     gtgttgccgc gcatttcgtc gaatgtctct gttcatccga tcgagccgga tgctgatcca       720
     atgagcgact ggctgatgtc gctgaaaaag attgcgggta acgtaccgga cgatgtgctc       780
     gtattgccag gtcataacga atgcttccac ggtttgcatg cgcgccttgc aggcctcgca       840
     gcgggacagg acgcggcttt cgagcgtctg agagcggcgc tggcgaaggg gcctggccgt       900
     gtggtggacg tatttccggc gttgtttcga cgacccatta ctggaagtga tgcacagttg       960
     ttggggctcg cgactggcga gagccaggcc tgcctgaatt acctgctgta tcggggagaa      1020
     atctcggtgg acgttgatgc cgatggggtg cgctggtata gcctttgcga gccaggaagt      1080
     gaagcgagtg gcagttga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page