(data stored in ACNUC7421 zone)

EMBL: CP000272.PE250

CP000272.PE250       Location/Qualifiers
FT   CDS_pept        276885..277160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0254"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36178"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB1"
FT                   /protein_id="ABE36178.1"
FT                   /translation="MLVSRSPSMHGIGHAASGREAPRKLHPLRRYLYAGNFRVGLPAVL
FT                   CQDIGLVDGMGRRAESSAMVVSGVPAGNAGLVRASQTPSTVRIRYS"
     gtgctggtca gtcgcagccc ttccatgcac ggtatcggtc atgcagcgtc aggtagagaa        60
     gcgccacgga agcttcatcc attgcgtcgg tatttatatg cgggcaattt ccgcgtcggc       120
     ttgccggccg tactgtgcca agacattggt ctggtagacg gtatggggcg cagggccgaa       180
     tcctctgcca tggtcgtttc tggcgttccc gccgggaacg ctggactcgt cagggcatcg       240
     caaacgcctt ccaccgtacg gatccgatat tcatag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page