(data stored in ACNUC7421 zone)

EMBL: CP000272.PE251

CP000272.PE251       Location/Qualifiers
FT   CDS_pept        complement(277155..277682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0255"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0255"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36179"
FT                   /db_xref="InterPro:IPR021769"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IB0"
FT                   /protein_id="ABE36179.1"
FT                   /translation="MAYRQRHRISARRNSEMHGEHTDTWSQTVALLDHGLAHQMMDTLA
FT                   RIAAAHPQKTAWSHHPALTVRVIERTSARTVSVSWCDPLSGYYGYQSWHASLARRRASC
FT                   VLSGEPISRGDPVYQPSSRPSRPGNAGAMILASRVDAALRVDHQPAGHEVAAGATGRTD
FT                   GAGCCGLQEGAL"
     atggcgtacc ggcaacgtca tcggatatcc gctcgaagga acagcgaaat gcatggagaa        60
     cacacggata cgtggtcgca gacagtcgcc ctgctcgatc atgggcttgc ccatcagatg       120
     atggacacgc tcgcacggat cgcagctgcc catccgcaga aaaccgcctg gagccaccac       180
     ccagccctca ccgtgcgtgt aatcgagcgg accagcgccc ggacggtctc ggtgtcgtgg       240
     tgcgatccgc tctctggcta ttatggatac cagtcctggc atgcatcact ggcaaggcgc       300
     cgcgccagtt gtgtactcag tggcgagccc atcagccggg gagatcccgt ctaccagccg       360
     tcctcgcggc catcgcgccc tggcaatgcc ggggccatga tcctcgcatc ccgcgtggat       420
     gccgcactgc gggtggatca tcagccggcg ggtcacgagg tcgccgccgg ggccacaggc       480
     cggacagatg gcgctggatg ttgtggcctt caggaaggag ccctatga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page