(data stored in SCRATCH zone)

EMBL: CP000272.PE253

CP000272.PE253       Location/Qualifiers
FT   CDS_pept        278560..279099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0257"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0257"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36181"
FT                   /db_xref="GOA:Q13IA8"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA8"
FT                   /protein_id="ABE36181.1"
FT                   /translation="MNNILRSTAAPALLVLAFTTGSAWAQTPASGAAAPASTAQTGGHA
FT                   KKHQDFVEQRIDELHAALKITDQQSQQWDAFAQTMRDNAKDADQAFRERASKLGSMTAD
FT                   EAMKSYASITQLHAQNMQKLATAFSALYATLSDDQKKTADVLFRNEHKHGKRHGPQRQH
FT                   KPAAGGAASAPVPASD"
     atgaacaaca tccttcgtag taccgcagcg ccagcgttgc tggtgcttgc ttttacaacc        60
     ggttctgcgt gggcgcagac gccggcaagc ggcgctgctg cacccgcttc gaccgcgcaa       120
     acaggcggcc atgccaaaaa gcatcaggat tttgtcgagc agaggatcga cgagctgcat       180
     gcagcgctga agatcactga ccagcagtcg cagcagtggg acgcctttgc gcaaaccatg       240
     cgtgataacg caaaggacgc agatcaggcg tttcgtgaac gcgcaagcaa gctcggttcg       300
     atgaccgccg acgaggcgat gaagtcctat gcttccatta cccagctaca tgcgcaaaac       360
     atgcagaagc tggccaccgc gttcagcgca ctgtatgcga ccttgtcgga cgaccagaaa       420
     aagacggcgg acgtactgtt tcgcaatgag cataaacacg ggaagcgtca cgggccgcag       480
     cgccagcaca agcccgctgc aggcggggcg gcttctgccc cggtgccggc ctctgactga       540
//

If you have problems or comments...

PBIL Back to PBIL home page