(data stored in SCRATCH zone)

EMBL: CP000272.PE259

CP000272.PE259       Location/Qualifiers
FT   CDS_pept        286615..286980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0264"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36187"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IA2"
FT                   /protein_id="ABE36187.1"
FT                   /translation="MAVGSAKLQMADRELLRREETVPGEQQAIAAKSSACFPGGLQPVK
FT                   QGDYRMRCAGPDSRGSGAASVDEAPRTHIWLSPLEDLAFEKRQPPVWKTIGDCAGFAAG
FT                   RSRSARQASATQPVMLV"
     gtggcggtcg ggagcgcaaa gctgcagatg gccgaccgtg agctattgcg ccgcgaggaa        60
     accgtgcccg gcgaacaaca ggcaattgcc gcgaaaagtt cggcgtgttt cccgggcggt       120
     cttcaacctg ttaagcaagg cgattatcgt atgcgctgcg ccgggcccga tagtcgcgga       180
     tccggcgcgg cttccgtgga cgaagctccg cgaacgcata tctggctgtc gccgctggag       240
     gacctcgctt ttgagaagcg tcagccgccc gtctggaaga ctatcggcga ttgcgccggc       300
     ttcgcagcgg gtcgctcgag gtctgctcgt caggcatcag ccacgcagcc ggtcatgtta       360
     gtgtga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page