(data stored in SCRATCH zone)

EMBL: CP000272.PE270

CP000272.PE270       Location/Qualifiers
FT   CDS_pept        complement(298008..299516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0275"
FT                   /product="Conserved hypothetical protein"
FT                   /note="NHL repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0275"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36198"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I91"
FT                   /protein_id="ABE36198.1"
FT                   /translation="MRFGPDGKLYVAQCFGSQISAIDTRNGAATTVTPVGSDIVAPDDL
FT                   AFDSKGNLFATEVMTDRVSMRSADGTVRVLNDGLPTANGITVHGDRIFVDEFRVGGRVL
FT                   ELYTDGRSPRVIAENLTLPNALSMGPDGKLYFPLVATGEVWRVAVENGSPECVVSGLSI
FT                   PTAVKFDVRNGGLVVTEAGSGEVTWVDVVSGKRKTLATLRPGSDNLVFDGDGRLFVSHF
FT                   TDGGITEIGADGNIRTLVAPGLVGPFGIAVDGGGSVYIADGMTLAVVDTSGQLHQPANL
FT                   LNHGFPGYIRGIAVSDGGTVFVTNSAGGLARYRAGEEATFLLPDLDQPMGLAALPNGAI
FT                   RVCEAGRGRVIEYAPDGSTHTLASGLRFPTGIACTAQGRSFVSEGAGGRVVELHHGVVS
FT                   TVLDGLVEPHGLAIAGAALYVLDRGARTLYAVSLEDGSTEQLSHSLPVGPAPNIVPRQL
FT                   PGIKNLMPGPLHSFAGLAADRTGAIYVSCDGDGSVRRLCREAAV"
     atgcgctttg gcccggatgg caagctctat gtcgcgcaat gcttcggcag tcagatcagc        60
     gcgatcgata cacgtaatgg cgcggccacc acggtcacgc cagtcggcag cgacatcgtc       120
     gcacctgatg accttgcctt cgattcaaaa ggcaatctgt tcgccacgga ggtcatgaca       180
     gaccgcgtga gcatgcgctc tgccgacggc accgtgcgcg tgctcaacga tggcctgccg       240
     acagccaacg ggatcacggt tcacggcgac cgcattttcg ttgacgaatt ccgtgtcggc       300
     ggtcgcgtac tcgaactcta caccgatggc cgttcgcctc gcgtaatcgc ggaaaacctc       360
     acgctgccga acgcactgtc gatgggcccc gatgggaagc tatattttcc gcttgttgcc       420
     acgggcgagg tctggcgagt cgctgtcgag aatggctctc cagaatgcgt cgtaagcggt       480
     ctatcgatcc ccaccgcagt gaaatttgac gtgcgcaatg gtggactggt cgtaactgaa       540
     gcgggttcag gcgaggtcac ctgggttgac gttgtcagtg gcaagcgcaa aacgctcgcg       600
     acgttgcggc ccggctcgga caatcttgtc ttcgatggag acggccgact gttcgtttcg       660
     catttcaccg acggcggcat caccgagatc ggcgctgacg gcaacatccg gaccctggtc       720
     gctcccggcc tcgtcggacc attcgggatc gcggtcgacg gcggtggatc agtctacatc       780
     gccgacggca tgacgctggc agttgtcgac acttccggac agttgcacca gccagcaaac       840
     ctgctaaatc acggctttcc cggctacatt cgcggcatcg ctgtgagcga cggcggcacc       900
     gtttttgtga ccaatagcgc gggcgggctc gcgcgttatc gtgcgggtga ggaagccacg       960
     ttcctgctgc ccgacctcga tcagcccatg ggtcttgccg cgctaccgaa tggagctatc      1020
     cgcgtgtgcg aggcaggacg cggacgcgtc atcgagtacg cgccggatgg aagcactcac      1080
     acgctcgcga gtggcttgcg ttttccgact ggcatcgcct gcacggcgca aggtcgcagt      1140
     ttcgtctccg agggtgccgg cgggcgggtg gtcgaacttc accatggcgt tgtctcgacg      1200
     gtactcgacg ggcttgttga accacacgga ctggccatcg caggcgctgc gctgtacgtc      1260
     cttgatcggg gtgccaggac gctatacgct gtctcgctgg aggacggttc cacggaacag      1320
     ctctcccatt ccctaccggt tggtcccgct ccgaacatcg tcccgagaca gctacctggt      1380
     atcaagaacc tgatgccggg gcccttgcat tcgttcgcag gactcgctgc cgacaggact      1440
     ggggcgatct acgtttcatg cgatggtgac ggcagtgttc ggcgtctgtg ccgtgaggcg      1500
     gccgtgtag                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page