(data stored in SCRATCH zone)

EMBL: CP000272.PE284

CP000272.PE284       Location/Qualifiers
FT   CDS_pept        315695..316645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0289"
FT                   /product="Putative iron-sulfur oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0289"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36212"
FT                   /db_xref="GOA:Q13I77"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I77"
FT                   /protein_id="ABE36212.1"
FT                   /translation="MDKAQEINLVVRAITQEADGVIGLTLAAADGQDLPVWTPGAHIGL
FT                   LVDGGLERQYSLCSEPEDRRQWRIAVLREPESRGGSAWLHSRLQVGDILRATGPGNQFE
FT                   LVDADRYVFVAGGIGITPLLPMIRAVEARGAQWSLLYGGRHRSSMAFAAALEAYGERVR
FT                   IQPEDQCGLLDLKAALGAPQAGVAIYSCGPERLLEAVEATCVGWPEGALHVERFRPRPG
FT                   ALEGESGSFEVVLAKSNLSCQVREGQTIIDALDTAGFHVPRSCGEGTCGTCVAKVLEGV
FT                   PDHRDSFLMGKKRAANQTICVCCSRSLTPRLVLDL"
     atggataaag cgcaggaaat taacctcgtc gtgcgggcca tcacccagga ggctgatggt        60
     gtgatcggcc tgacacttgc agccgcggat gggcaggatc tgccggtgtg gacgccaggt       120
     gcccatatcg gcctcctggt cgacggcggg ctggagcgcc aatactcgct gtgcagtgaa       180
     cctgaagacc gccggcaatg gcgcatcgcg gtgctacgcg agcctgaaag ccgcgggggc       240
     tccgcttggc tgcattcccg tctccaggtt ggcgacatac tccgtgcgac agggccgggc       300
     aaccagttcg aactggtgga tgccgatcgc tatgtgttcg tcgccggcgg aatcggcatt       360
     accccgctac tgccgatgat ccgtgccgtc gaagcccggg gcgcacaatg gagcctgctg       420
     tacggcggac gccatcgcag ttcgatggcc tttgccgccg cgctggaagc atacggcgag       480
     cgggttcgga tccagccaga ggatcagtgc gggctgctcg acctgaaggc ggcactcggc       540
     gcgccccagg ctggagtcgc tatatacagt tgcggtcctg aacgtctgct cgaagcggtc       600
     gaggccacgt gcgtgggctg gccggagggt gccttgcatg ttgagcgttt ccggccccgt       660
     cccggcgcgc tggaaggcga gagcggctcg ttcgaggtcg tgctcgcaaa aagcaacctg       720
     tcctgccagg tccgggaagg ccagaccatc attgatgcgc tcgatacggc cgggttccat       780
     gtgccacgct cgtgcggtga aggcacgtgt ggaacatgcg tggcgaaggt gctcgaaggt       840
     gtgccggacc accgtgattc cttcctcatg ggcaagaagc gcgcggccaa ccagaccatc       900
     tgtgtgtgct gttcgcgctc cctcacacca cggctcgtgc tggatctcta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page