(data stored in SCRATCH zone)

EMBL: CP000272.PE296

CP000272.PE296       Location/Qualifiers
FT   CDS_pept        330435..330758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0301"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0301"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36224"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I65"
FT                   /protein_id="ABE36224.1"
FT                   /translation="MSRKLIYGVFTFFQPWGDLMRWMDEALDIQHVKNWAILNPSIEDG
FT                   SESCVQQLDAFCRSAQGFRRFPALEQFPLVARGLPARVILNPGTQLAGVRRHGDRVSSL
FT                   RIN"
     atgtctcgca agttaattta tggagtcttt actttttttc agccttgggg agatcttatg        60
     agatggatgg acgaagcgct ggatatacag catgtaaaga actgggctat tctgaatccg       120
     tctattgaag acggttccga atcttgtgtt cagcaattgg acgctttttg tcgctctgcc       180
     caaggattcc gccgcttccc ggcactcgaa caattcccgc ttgtggcccg aggtcttccc       240
     gctcgggtaa tactcaatcc ggggacgcag ttggctggcg tgcgccgtca tggtgatcgc       300
     gtttctagtc ttcgaatcaa ttga                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page