(data stored in SCRATCH zone)

EMBL: CP000272.PE299

CP000272.PE299       Location/Qualifiers
FT   CDS_pept        complement(333837..334439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36227"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I62"
FT                   /protein_id="ABE36227.1"
FT                   /translation="MGMLSSSCASVNVGVNYRAPSAKPENGLTRSDSRPKSLSVPGCSV
FT                   YSTVRICAAISLSTVSEVGNRFATRRGNLAGRSPGVRNTGPLPITRRHTRQTNQRRAAD
FT                   TADRRSVATIVAGLLCSPLPETKLALIDVNRPGAVQYSNPMTFAASWWTSMFCASCASA
FT                   CHGRTLGIVGLGGAGRHVARYGMAFGIVYADRKFSHK"
     ttggggatgt tatcttcgtc atgcgcaagt gtcaacgtgg gtgtcaacta ccgcgctcca        60
     agcgcgaaac cggaaaatgg cctcactcgt tcggacagtc gtccgaaatc cttaagtgtc       120
     cccgggtgtt ccgtttattc gactgtccgg atttgtgcag ccatctctct ttccacggta       180
     tcagaggtcg gcaaccggtt tgccacgcgg cgaggcaacc ttgccggccg gtctcccggc       240
     gtacgcaata cgggtcctct acccattacc agacgacata ctcgtcagac gaatcaaagg       300
     cgtgctgcag acacagcaga ccggcgatca gtcgcgacga ttgtcgcggg tctgctgtgt       360
     tcgcctttgc ccgagacaaa gctcgcgctc atcgatgtga accgccccgg ggcggttcag       420
     tactcgaacc cgatgacatt cgcggcaagc tggtggactt cgatgttctg tgcgtcatgc       480
     gcgagcgcat gtcatggccg cactctcggc atcgtcggtc tgggcggcgc gggtcgccat       540
     gttgcacgct acggcatggc gttcggcatt gtttacgccg accgaaaatt cagccacaag       600
     tag                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page