(data stored in SCRATCH zone)

EMBL: CP000272.PE3

CP000272.PE3         Location/Qualifiers
FT   CDS_pept        complement(2190..2561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0003"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35931"
FT                   /db_xref="UniProtKB/TrEMBL:Q13J08"
FT                   /protein_id="ABE35931.1"
FT                   /translation="MAISIFIGPPIRPTVPPASRREQGAWQAHPGGHGIRLQVGTVDEI
FT                   RLFRSGSGHLGPGCFSYGKQARNFWLIPIPWLPKATPAAIGAKAAFAFPLPRTFERPFC
FT                   QEKAILRHAISGWRTGNAR"
     gtggcaattt ccatattcat tggcccaccg atacgaccca ccgttccgcc tgcgagcagg        60
     cgggaacagg gagcctggca agcacatccg ggcgggcatg gcattcgtct tcaggtcggc       120
     acggtggacg aaatccggct atttcgatca ggtagcggcc atctcggacc tggatgcttt       180
     tcgtacggaa aacaggccag aaatttctgg ctgatcccga ttccatggct gccaaaagct       240
     accccggcgg ctatcggtgc aaaagctgcc tttgccttcc ccctcccgcg aacattcgaa       300
     cgtccgtttt gccaggaaaa ggcaatcttg cggcacgcaa tcagcggctg gcgaacgggc       360
     aacgcccggt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page