(data stored in ACNUC7421 zone)

EMBL: CP000272.PE305

CP000272.PE305       Location/Qualifiers
FT   CDS_pept        complement(344115..344786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0317"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36233"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I56"
FT                   /protein_id="ABE36233.1"
FT                   /translation="MIPDSTLSIHEISAFVDAGIPPDTPPGEHLDPLTVEFIEYALRSS
FT                   VTTLDTQDAEQHAQRALSLGATTAQLHEILLLVSALGVHSLMAGSTKLARLGSPAGKPM
FT                   TLAPLTNEQQALHQKYVGESSYWRRFEEAIPGFLDSLLRFSPEGFEAFFNFCALPWHKA
FT                   TVPALTKELISIAVDATPSHRFLPGVRIHVGNALTLGCGRTALREVLAIAARAPVHSGV
FT                   R"
     gtgatccccg attcaacgct atcgatccat gagattagcg ctttcgtcga tgccgggatc        60
     ccgccggaca cgccgccggg cgagcacctg gatcctctga cggtcgagtt catagagtac       120
     gcgctcaggt catcggtcac gactctcgac acacaagacg cagaacagca tgcgcagcgg       180
     gcgctgtctc tcggagccac aaccgcccag cttcacgaga ttctattgct ggtctccgca       240
     ctcggagtcc acagcctgat ggccggctcg acgaagctgg cccgactcgg ctctccggcc       300
     ggaaagccga tgacgctggc gccactgaca aacgaacaac aagcgttgca tcaaaaatat       360
     gtcggcgaat ccagctactg gcgccgattc gaggaggcta ttccgggatt tctggactcg       420
     ctgctccgat tctctcctga agggttcgag gcgttcttca atttctgcgc gctgccttgg       480
     cataaagcaa ccgttccggc gttgaccaag gaattgatat ccatcgcggt ggatgcaacg       540
     ccatcgcacc gctttcttcc tggcgttcgc atccatgttg gcaacgcgct gacgctggga       600
     tgcgggcgaa cagccctgcg cgaggtactc gctatcgcgg cgcgcgctcc tgtgcacagc       660
     ggagttcgct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page