(data stored in ACNUC7421 zone)

EMBL: CP000272.PE31

CP000272.PE31        Location/Qualifiers
FT   CDS_pept        39430..40050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0032"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxG
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35959"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IY0"
FT                   /protein_id="ABE35959.1"
FT                   /translation="MKVVLEKVFPLAATADSAWQLMQDIEAVAGCMPGAKITERVDATH
FT                   YKGTITVRLGPATMSFKGDIEVLDLDRASRRLHLTGKGADASGTSAASMDLVAAVRATG
FT                   ESCELTGKSEVTMSGKAASLGGRLMGPVSEQMLRQFVANFAARLPAVQAQQTALPGGAA
FT                   QPQTQPPAATPDTAAPPSELNGLALAWAVVRDWLRGIFSRKTA"
     atgaaagtcg tactcgaaaa ggtgtttccg ctggccgcca cggcggacag cgcgtggcaa        60
     ctgatgcagg acatcgaggc ggtggccggc tgcatgccgg gcgcgaagat taccgaacgc       120
     gtcgacgcca cgcattacaa agggacgatc acggtgcggc tcgggccggc cacgatgtcg       180
     ttcaagggcg acatcgaagt gctggatctc gacagggcgt cgcgcaggct gcatctgacc       240
     ggcaagggtg cagatgcaag cggaacctcg gcggcctcga tggatctggt cgccgcggtg       300
     cgggcaaccg gcgagagctg cgagttgacc ggcaagagcg aagtgacgat gagcggcaag       360
     gccgcttcgc tcggcggccg gctgatgggg ccggtatcgg agcagatgct ccggcagttc       420
     gtggcgaact tcgcggcacg gctgccggcc gttcaggcgc agcagaccgc gctgccgggg       480
     ggcgcagcgc agccgcagac gcagccgcct gcagcgacgc ccgacaccgc cgcgccgcct       540
     tccgaactga acggcctcgc gctcgcatgg gccgtggtgc gcgactggtt gcgcgggatc       600
     ttctcccgca agacagcttg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page