(data stored in SCRATCH zone)

EMBL: CP000272.PE314

CP000272.PE314       Location/Qualifiers
FT   CDS_pept        356628..357200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36242"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I47"
FT                   /protein_id="ABE36242.1"
FT                   /translation="MLTKSHVKGTLDTSIYTTLRHAMIVNSDNLISNVQKLVDRADIER
FT                   VLYEYAFHLDAADPEQMLPLFTADLHVAYGPNHGAVGAEAYLETLSNDKSGIASFFAAT
FT                   SHHVSNVVIDFTGADTATVRSVLYAYHKYNRERPDGIVMGQYHDEFVRTPEGWKIKRRE
FT                   LKHAGTENYHAKGAALNPIPRKSIQKA"
     gtgttgacta agtcgcatgt caagggtacg ctggatacct cgatttacac aacattgaga        60
     cacgccatga tcgtcaattc agacaacttg atttccaacg ttcagaaact ggtcgatagg       120
     gccgatatcg aacgcgtcct gtacgaatac gcgttccatc ttgacgcggc agacccggag       180
     cagatgcttc cgttgttcac ggcggacctg catgtggcct atggtcccaa ccatggcgca       240
     gtcggcgccg aggcttatct tgaaacgctt tccaacgaca agtccggcat tgcatcattc       300
     ttcgccgcta cgagccatca tgtgtcgaac gtcgtcatcg attttaccgg cgccgacacc       360
     gcgacggttc gctcagttct gtatgcttat cacaagtaca atcgcgagcg cccagacggc       420
     atcgtcatgg gccaatacca cgatgaattt gttcgtacac cggaaggctg gaagatcaag       480
     cgacgcgagc tgaaacacgc gggtaccgag aattatcacg ccaaaggcgc ggcgctgaat       540
     ccaattccgc gaaaaagcat tcaaaaggcc tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page