(data stored in ACNUC7421 zone)

EMBL: CP000272.PE321

CP000272.PE321       Location/Qualifiers
FT   CDS_pept        complement(365190..365531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I40"
FT                   /protein_id="ABE36249.1"
FT                   /translation="MSTRGRVVALTRLTRSELPASISQQAIYIGDTVMGTSDTVSLTGD
FT                   GIVERRIRVRESVISLAACSVHRANESGNPLCSFAAYADSMHDAHRQMLASGHDSFGRE
FT                   SRAHRGVDS"
     atgtccacgc gcggccgtgt cgtagcgctg acacgattaa cgcgtagcga actgccagcc        60
     tcgatctcac aacaggctat ctacatcgga gacacggtga tgggaacaag tgacactgta       120
     tccctgacag gcgacggcat cgtcgagcgt cgaatacgcg tacgggaaag cgtgatttcg       180
     ctggctgcct gcagcgtgca ccgcgccaac gagagcggaa acccactttg ttccttcgcg       240
     gcgtatgccg attcgatgca cgatgcgcac cggcaaatgc tggcctccgg acacgactcc       300
     ttcggtcgcg aatcccgggc acacagggga gtagactcgt ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page