(data stored in ACNUC7421 zone)

EMBL: CP000272.PE323

CP000272.PE323       Location/Qualifiers
FT   CDS_pept        365885..366163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0336"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36251"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I38"
FT                   /protein_id="ABE36251.1"
FT                   /translation="MNSRNPAVRCLVNDASISRLLCDYAYHLDMSHAANSRICLSTTAR
FT                   SSMVRTSGQAGAAYVETLKGRLVLRGQALRSFSVSCTGCQGHGWFAR"
     atgaattcgc gcaatccagc ggtccggtgc ctggtgaacg acgcaagcat tagccgactg        60
     ctttgcgact acgcgtacca cctcgacatg agccatgcgg cgaactcgag gatctgtttg       120
     tcgacgacgg cgaggtcgtc aatggttcga acttcggggc aagctggcgc ggcctacgtg       180
     gagacactga aggggcggtt agtgcttcgt ggccaggctt tacgaagctt ctccgttagc       240
     tgcacaggct gccagggaca cggttggttc gcgcgctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page