(data stored in ACNUC7421 zone)

EMBL: CP000272.PE328

CP000272.PE328       Location/Qualifiers
FT   CDS_pept        complement(374194..374535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36256"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I33"
FT                   /protein_id="ABE36256.1"
FT                   /translation="MSQVHSLPSSSSWHRRQDIISYQYSLLSIGSFWQTLPFRETCHTG
FT                   PQLRGHPIAYNLRMPDVAPPRPFPDTAPLSALRAWYAGVGSRQAVERYCPQALEGGQPA
FT                   CGFADKAPA"
     ttgagtcaag tccatagctt gccatcatcc agtagctggc atcggaggca agatatcata        60
     tcctatcaat actccttatt atcgatagga tcattctggc agacacttcc atttcgggaa       120
     acgtgtcaca ccggaccgca gctccgcggc catcccattg cctataacct ccggatgcca       180
     gacgttgcgc cgccacgacc ctttcccgac actgcgcccc tgtccgcgct gcgcgcgtgg       240
     tatgcgggcg ttggctcgcg acaggcggtc gagcgctatt gtccgcaagc gctcgaaggg       300
     ggccagccgg catgcggctt cgccgacaaa gcgccggcct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page