(data stored in ACNUC7421 zone)

EMBL: CP000272.PE33

CP000272.PE33        Location/Qualifiers
FT   CDS_pept        40953..42155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0034"
FT                   /product="Putative carbon monoxide dehydrogenase, CoxE
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE35961"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR011195"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q13IX8"
FT                   /protein_id="ABE35961.1"
FT                   /translation="MLTGIDGAAAPRPQPSGLEEALTARYAGFAGWLRANDFQVTGSDV
FT                   AASMEVALRMGQLDSQVLRWSLRALLCSRAQEWRRFDELFDAYFFAPNRRKQVETRAGG
FT                   AGRIEPDPAAGQRDGSEGAPLSPASGGGAAPPDGSTAEQGACGEASLAQADFRHLNQPD
FT                   ELFAIDTAIRRFAQRLQGIQLRSERRANAGSVIDMAWTVRRSVSRGGLPLELGWRRKRR
FT                   LRPRIVLLLDVSRSMSLYSFFYLRLARVLSARVSDVHCFIFHTRLVAIEQALRDPDPWR
FT                   SQERLQLLSAGWAGGTRIGDSLDEFNRQQATRLLHSRTAVVVVSDGYDAGEPERLQQAL
FT                   ATMRRRCRCVVWLNPLASRADFAPASAGMQAALPYIDLLAGARDLASLERVLPQVLSVL
FT                   Q"
     atgctgaccg gcattgacgg cgccgccgcg ccacgtcccc aaccctcggg cctcgaagag        60
     gcgctgacgg ctcgctatgc cggcttcgca ggctggctgc gcgcgaacga ttttcaggtg       120
     acgggcagcg acgtggccgc gtcgatggag gtggcgctgc gcatgggcca actggacagc       180
     caggtgttgc gctggagcct gcgcgcgttg ctgtgttcgc gcgcgcagga gtggcggcgc       240
     ttcgacgaac tgttcgatgc gtatttcttc gcgccgaacc gccgtaagca ggtcgaaacg       300
     cgcgctggcg gcgcgggccg gatcgagccg gaccccgctg ccggacagcg cgacggcagc       360
     gaaggcgcgc cgctgtcgcc ggcgtcgggc ggcggcgcgg cgccgcccga cggcagcacg       420
     gccgagcagg gcgcctgcgg ggaagcgtcg ctggcgcagg cggatttccg ccacctgaac       480
     cagcccgacg aactgttcgc catcgacacc gcgatccggc gcttcgcgca acgcctgcaa       540
     ggcatccagt tgcgcagcga acggcgcgcg aacgcgggga gcgtgatcga catggcctgg       600
     acggtgcgcc gcagcgtctc gcgcggcggc ctgccgctcg agctcggctg gcggcgcaag       660
     cggcggctgc ggccgcgcat cgtcctgctg ctcgacgtga gccgctcgat gagcctgtac       720
     agctttttct atctgcggct cgcgcgcgtg ctcagcgcgc gagtgtccga cgtgcattgc       780
     ttcatcttcc acacgcggct ggtcgccatc gaacaggcgc tgcgcgaccc ggacccgtgg       840
     cgctcgcagg agcgcctgca attgctgtcg gccggatggg cgggcggcac ccgtatcggc       900
     gacagtctcg acgagttcaa tcggcagcag gccacgcggc tgctccattc gcgcacggct       960
     gtcgtggtgg tgagcgatgg ctacgatgcg ggcgaacccg aacgcctgca gcaggcgctc      1020
     gccacgatgc ggcgccggtg ccggtgtgtc gtgtggctca atccgctggc gagccgtgcg      1080
     gatttcgcgc cggccagcgc cggcatgcag gcagcgcttc cctatatcga tctgctggcc      1140
     ggcgcgcgcg atctcgcgag tctggagcgc gtgctgccgc aagtgctgtc ggttctgcaa      1200
     tga                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page