(data stored in ACNUC7421 zone)

EMBL: CP000272.PE330

CP000272.PE330       Location/Qualifiers
FT   CDS_pept        complement(376062..376628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0346"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36258"
FT                   /db_xref="GOA:Q13I31"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I31"
FT                   /protein_id="ABE36258.1"
FT                   /translation="MQKRKICQQHNILRLAAVLALAATSISARADGFGVQLAAGVADHD
FT                   VKKGDLGIVWDPGLKWWEIGGYHFTVVGEAHAAYWAVREDHATHPDIWEFGLTPVLRFV
FT                   RSSGWFRPYIEAGVGVRLLSHVRETQDRTFSSSFQFADMVGVGAQFGDHQNYQAGFRFQ
FT                   HLSNAGLEHPNPGINFSEIYVQYNF"
     atgcagaaaa gaaagatttg ccagcaacac aatattctgc gcctcgcggc ggtcctggcg        60
     ctggcggcga cgtcaataag cgcgcgtgcc gacggattcg gcgtgcaact ggcggcaggt       120
     gtcgcggacc atgacgtgaa aaagggcgat ctgggtatcg tctgggaccc ggggctgaaa       180
     tggtgggaaa tcggtggcta tcatttcacc gttgttggcg aagcccatgc cgcttactgg       240
     gccgtccggg aagaccacgc cacccatccg gatatctggg aattcggact cacgccggtg       300
     ttgcgcttcg tcaggagctc gggctggttc cgcccatata tagaggccgg agtgggtgtc       360
     cggctgctat cgcatgtacg ggaaacgcag gaccggacgt tctcgtcgtc attccagttc       420
     gccgacatgg tcggtgtcgg tgcgcaattc ggcgaccatc agaactatca ggccggtttc       480
     cgcttccagc atctgtcgaa cgcaggcctc gagcacccga acccgggtat caacttcagc       540
     gagatttatg tgcaatataa cttctga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page