(data stored in ACNUC7421 zone)

EMBL: CP000272.PE335

CP000272.PE335       Location/Qualifiers
FT   CDS_pept        complement(380633..381058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bxe_C0351"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bxe_C0351"
FT                   /db_xref="EnsemblGenomes-Tr:ABE36263"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="UniProtKB/TrEMBL:Q13I26"
FT                   /protein_id="ABE36263.1"
FT                   /translation="MSSVQTEIPLDPNSRPHWEAATRGVLLVQRCTDCGTHRFPAAWQC
FT                   AHCHGRNAEWVALSGLGRIESFCTFHKAYWPSVRDQLPYTVVQVMLDEGVRYMSSMAGN
FT                   PGPQMQIGLRVRAWFDPVSPTLTLIRFAPADAPAPRS"
     atgagttcag tacagaccga aattccgctc gacccgaaca gccggcccca ctgggaagcg        60
     gccactcgcg gcgttctgct ggttcagcgt tgcacggatt gtggaacaca ccggtttccc       120
     gccgcgtggc aatgcgcgca ttgccacggg cgaaacgcag agtgggttgc gctcagcggc       180
     ctcgggcgca tcgaatcgtt ctgcaccttc cataaggcgt actggccatc ggtccgggac       240
     cagcttccgt ataccgtcgt gcaggtcatg ctggacgaag gcgtacgtta tatgagcagc       300
     atggccggca accctgggcc gcagatgcag ataggcctgc gcgtacgggc atggttcgac       360
     ccggtttccc cgacgctcac cttgatccgc tttgcgcccg ccgacgcacc agcgcctcgt       420
     tcatag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page